IFN-alpha 1/IFNA1 Protein, Mouse (HEK293, hFc)

IFN alpha 1a Protein, synthesized by macrophages, exhibits robust antiviral activities by stimulating key enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response enhances the host's immune defenses against viral threats. IFN-alpha 1/IFNA1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived IFN-alpha 1/IFNA1 protein, expressed by HEK293 , with C-hFc labeled tag.

IFN alpha 1a Protein, synthesized by macrophages, possesses potent antiviral activities. Its primary role involves the stimulation of two pivotal enzymes—a protein kinase and an oligoadenylate synthetase. This orchestrated molecular response plays a crucial part in enhancing the host's immune defenses against viral threats.

Human IFN alpha/beta R1, His Tag captured on CM5 Chip via anti-his antibody can bind Mouse IFN alpha 1, hFc Tag with an affinity constant of 11.96 nM as determined in SPR assay (Biacore T200).

Mouse

HEK293

C-hFc

P01572 (C24-K189)

15962  [NCBI]

Full Length of Mature Protein

CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Approximately 45-60 kDa, based on Tris-Bis PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.