1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 5
  6. IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, Fc)

IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P76459
Handling Instructions Technical Support

IFN-alpha 5 (IFNA5), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, Fc) contains 189 a.a. (M1-E189), produced in HEK293 cells with a C-terminal hFc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 5 (IFNA5), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, Fc) contains 189 a.a. (M1-E189), produced in HEK293 cells with a C-terminal hFc-tag.

Background

IFN-alpha 5 (IFNA5; IFN-α5), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[1].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[2].
IFN-alpha 5 involves in innate immunity, and is one of the genes associated with acute viral bronchiolitis (AVB) caused by respiratory syncytial virus (RSV), determining susceptibility to RSV bronchiolitis[3][4].
The excessively expressed interferon-α (IFN-α) might contribute to the uncontrolled inflammatory responses, causing pathological damage during influenza virus infection. However IFN-alpha 5 is dominantly expressed in respiratory epithelial cells from the patients infected with less pathogenic infectious bronchitis virus (IBV)[5].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA5 protein of mouse is very different from human (60.32%).

In Vitro

IFN-α subtype shows dominance in mouse lungs infected with influenza viruses. IFN-α1, IFN-α5, and IFN-α9 are dominantly expressed in the lungs of the mice infected with H1N1 influenza viruses accompanied with the high-level production of CXCL1, more infiltrated neutrophils and more severe damage in mouse lungs[5].

In Vivo

Type I interferons (IFNs) are produced early in response to viral infection and modulate adaptive immunity. Thus IFNA5 enhances the replication of murine cytomegalovirus (MCMV) and helps little about systemic murine cytomegalovirus (MCMV) infection and myocarditis[6].

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q810G2 (C24-E189)

Gene ID
Molecular Construction
N-term
IFNA5 (C24-E189)
Accession # Q81G2
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-5; Interferon alpha-61; Interferon alpha-G; LeIF G
AA Sequence

CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLKACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLARLSKEE

Predicted Molecular Mass
46 kDa
Molecular Weight

Approximately 48.8 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 5/IFNA5 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76459
Quantity:
MCE Japan Authorized Agent: