1. Recombinant Proteins
  2. IFN gamma Protein, Mouse

IFN gamma Protein, Mouse

Cat. No.: HY-P70522
Handling Instructions

IFN gamma Protein, Mouse is a cytokine that plays physiologically important roles in promoting innate and adaptive immune responses[1] [2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $60 In-stock
Estimated Time of Arrival: December 31
50 μg $180 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Ifng; Interferon gamma; IFN-gamma
Species

Mouse

Source

E. coli

Accession

P01580

Gene ID

15978

Molecular Weight

Approximately 14.0 kDa

AA Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
The ability to inhibit the proliferation of murine WEHI-279 cells has an ED50 value of 1 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute at 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

Interferon gamma (IFN-gamma) exerts a variety of immunoregulatory effects on several cell targets. It is generally assumed that IFN-gamma is specifically produced by T and large granular lymphocytes. IFN-γ drives inflammatory bowel disease pathogenesis through VE-cadherin-directed vascular barrier disruption[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN gamma Protein, Mouse
Cat. No.:
HY-P70522
Quantity:
MCE Japan Authorized Agent: