IFN-gamma Protein, Mouse

IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag^[1][2][3][4].

IFN-gamma is a cytokine with immunomodulatory, antitumor, and antiviral properties. IFN-gamma can activate macrophages and NK cells, regulate T-cell differentiation, and participate in inflammatory responses. IFN-gamma induces antiviral proteins to inhibit viral replication and enhances the immune recognition of infected cells. IFN-gamma also exerts antitumor effects by suppressing tumor cell proliferation, activating immune cells, and inhibiting tumor angiogenesis. Meanwhile, IFN-gamma promotes the expression of MHC molecules to improve the efficiency of immune cells in recognizing pathogens and abnormal cells. Additionally, IFN-gamma is involved in regulating the differentiation and maturation of bone marrow hematopoietic stem cells^[1][2][3][4].

IFN-gamma Protein (Mouse; 10 ng/mL; 24 h) can upregulate the expression of MHC-I and PD-L1 in tumor cell line MC38, and the effect is better when used in combination with Nintedanib (HY-50904)^[5].

IFN-gamma Protein (Mouse; 10 ng; intranasal administration; on days 1, 3, and 5 post-infection) after primary respiratory syncytial virus (RSV) infection in mice significantly alleviates airway hyperresponsiveness (AHR) and inflammation upon reinfection^[6].
IFN-gamma Protein (Mouse; 50,000 U/animal; intravenous injection; 3 times/week; 4 weeks) exhibits antitumor activity and reduces the number of lung metastatic foci in a mouse melanoma tumor model^[7].

1. Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED₅₀ is < 1 ng/mL.
2. Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED₅₀ for this effect is ≤0.7283 ng/mL, corresponding to a specific activity is ≥1.37×10⁶ Unit/mg.
3.Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED₅₀ for this effect is <135 ng/mL.
4. Measured by its binding abiity in a functional ELISA. Immobilized Mouse IFN gamma at 10 μg/ml (100 μL/well) can bind Mouse CD119 (HY-P72611). The ED₅₀ for this effect is <100 ng/mL.

• 
  Measured by its ability to inhibit the proliferation of HT-29 human colon cancer cells. The ED₅₀ for this effect is 0.1399 ng/mL, corresponding to a specific activity is 7.147×10⁶ Unit/mg.
• 
  When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED₅₀ for this effect is 74.54 ng/mL.

Mouse

E. coli

Tag Free

P01580 (H23-C155)

15978  [NCBI]

Full Length of Mature Protein

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68.  [Content Brief]

  [2]. Kursunel MA, et al. The untold story of IFN-γ in cancer biology. Cytokine Growth Factor Rev. 2016 Oct;31:73-81.  [Content Brief]

  [3]. Chesler DA, et al. The role of IFN-gamma in immune responses to viral infections of the central nervous system. Cytokine Growth Factor Rev. 2002 Dec;13(6):441-54.  [Content Brief]

  [4]. Goedhart M, et al. Interferon-Gamma Impairs Maintenance and Alters Hematopoietic Support of Bone Marrow Mesenchymal Stromal Cells. Stem Cells Dev. 2018 May 1;27(9):579-589.  [Content Brief]

  [5]. Tu J, et al. Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells. Theranostics. 2022 Jan 1;12(2):747-766.  [Content Brief]

  [6]. Lee YM, et al. IFN-gamma production during initial infection determines the outcome of reinfection with respiratory syncytial virus. Am J Respir Crit Care Med. 2008 Jan 15;177(2):208-18.  [Content Brief]

  [7]. Talmadge JE, et al. Immunomodulatory and immunotherapeutic properties of recombinant gamma-interferon and recombinant tumor necrosis factor in mice. Cancer Res. 1987 May 15;47(10):2563-70.  [Content Brief]