1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Mouse

IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

44 Publications Citing Use of MCE IFN-gamma Protein, Mouse

Cell Proliferation/Viability Assay
Flow Cytometry

    IFN-gamma Protein, Mouse purchased from MCE. Usage Cited in: Cancer Cell. 2025 Dec 8;43(12):2282-2297.e9.  [Abstract]

    Naive CD8+ T cells were cultured in medium alone or cocultured with SVEC4-10 cells, IFNγ (500 ng/mL; 72 h) -treated SVEC4-10 cells, or BMDMs, respectively, ± OVA 257-264 at 2:1 ratio for 72 h. Percentages of IFNγ+, CD69+, GZMB+, and Perforin+ were detected by FACS.

    IFN-gamma Protein, Mouse purchased from MCE. Usage Cited in: Cancer Res. 2025 Nov 11.  [Abstract]

    Flow cytometry was used to assess the surface expression levels of MHC-I in MDA-MB-468 cells under different TSPAN13 expression levels, with or without IFNγ(30 ng/mL; 24 h) stimulation.

    IFN-gamma Protein, Mouse purchased from MCE. Usage Cited in: Int J Surg. 2025 Jun 27.  [Abstract]

    IFN-γ (20 ng/mL; 48 h). Relative expression levels of circCCDC719-13 in THP-1 macrophages under different polarization states: M0 (unpolarized), M1 (classically activated), and M2 (alternatively activated).

    IFN-gamma Protein, Mouse purchased from MCE. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766.  [Abstract]

    PD-L1 expression after IFN-γ (10 ng/ml; 24 h ) treatment in MC38 cells.

    IFN-gamma Protein, Mouse purchased from MCE. Usage Cited in: Adv Funct Mater. 10 March 2022.

    Quantification of T cell proliferation with the supernatant from BMDM treated with LPS (50 ng/mL)/IFN-γ (20 ng/mL) for 48 h by flow cytometry.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag[1][2][3][4].

    Background

    IFN-gamma is a cytokine with immunomodulatory, antitumor, and antiviral properties. IFN-gamma can activate macrophages and NK cells, regulate T-cell differentiation, and participate in inflammatory responses. IFN-gamma induces antiviral proteins to inhibit viral replication and enhances the immune recognition of infected cells. IFN-gamma also exerts antitumor effects by suppressing tumor cell proliferation, activating immune cells, and inhibiting tumor angiogenesis. Meanwhile, IFN-gamma promotes the expression of MHC molecules to improve the efficiency of immune cells in recognizing pathogens and abnormal cells. Additionally, IFN-gamma is involved in regulating the differentiation and maturation of bone marrow hematopoietic stem cells[1][2][3][4].

    In Vitro

    IFN-gamma Protein (Mouse; 10 ng/mL; 24 h) can upregulate the expression of MHC-I and PD-L1 in tumor cell line MC38, and the effect is better when used in combination with Nintedanib (HY-50904)[5].

    In Vivo

    IFN-gamma Protein (Mouse; 10 ng; intranasal administration; on days 1, 3, and 5 post-infection) after primary respiratory syncytial virus (RSV) infection in mice significantly alleviates airway hyperresponsiveness (AHR) and inflammation upon reinfection[6].
    IFN-gamma Protein (Mouse; 50,000 U/animal; intravenous injection; 3 times/week; 4 weeks) exhibits antitumor activity and reduces the number of lung metastatic foci in a mouse melanoma tumor model[7].

    Biological Activity

    1. Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is < 1 ng/mL.
    2. Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is ≤0.7283 ng/mL, corresponding to a specific activity is ≥1.37×106 Unit/mg.
    3.Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED50 for this effect is <135 ng/mL.
    4. Measured by its binding abiity in a functional ELISA. Immobilized Mouse IFN gamma at 10 μg/ml (100 μL/well) can bind Mouse CD119 (HY-P72611). The ED50 for this effect is <100 ng/mL.

    • Measured by its ability to inhibit the proliferation of HT-29 human colon cancer cells. The ED50 for this effect is 0.1399 ng/mL, corresponding to a specific activity is 7.147×106 Unit/mg.
    • When Recombinant Mouse IFN gamma is used at 10 μg/mL can bind Biotinylated Mouse CD119 (HY-P72611). The ED50 for this effect is 74.54 ng/mL.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P01580 (H23-C155)

    Gene ID
    Molecular Construction
    N-term
    IFN-gamma (H23-C155)
    Accession # P01580
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rMuIFN-γ; IFNG; IFN-gamma; Interferon gamma
    AA Sequence

    HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

    Predicted Molecular Mass
    15.5 kDa
    Molecular Weight

    Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IFN-gamma Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IFN-gamma Protein, Mouse

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IFN-gamma Protein, Mouse
    Cat. No.:
    HY-P7071
    Quantity:
    MCE Japan Authorized Agent: