IL-10 Protein, Human (HEK293, His)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293, His) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with N-His labeled tag.

IL-10 Protein, a key immune regulatory cytokine, exerts potent anti-inflammatory effects to prevent excessive tissue damage caused by inflammation. It engages its heterotetrameric receptor, composed of IL10RA and IL10RB, triggering JAK1 and STAT2-mediated phosphorylation of STAT3. This leads to STAT3 translocation into the nucleus, driving the expression of anti-inflammatory mediators. IL-10 Protein targets antigen-presenting cells like macrophages and monocytes, inhibiting the release of pro-inflammatory cytokines. It also hinders antigen presentation by reducing MHC-class II and co-stimulatory molecule expression, thereby dampening T cell activation. Additionally, it reprograms metabolic pathways, including mTOR signaling, to control the inflammatory response of macrophages. The protein forms homodimers and interacts with IL10RA and IL10RB.

1.Immobilized human IL10-His at 10 μg/mL (100 μl/well) can bind Cynomolgus IL10RA-Fc and the EC₅₀ is 0.31-0.71 μg/mL.
2. Measured in a cell proliferation assay using MC/9-2 mouse mast cells and the ED₅₀ is typically 5-20 ng/mL.
3. Immobilized Human IL-10 Protein at 2μg/mL (100μL/well) can bind biotinylated Rhesus Macaque IL10RA Protein. The ED₅₀ for this effect is 0.727 μg/mL.

• 
  Immobilized Human IL-10 Protein at 2 μg/mL (100 μL/well) can bind biotinylated Rhesus Macaque IL10RA Protein. The ED₅₀ for this effect is 0.727 μg/mL.

Human

HEK293

N-His

P22301/NP_000563.1 (S19-N178)

3586  [NCBI]

Full Length of Mature Protein

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.