1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11
  5. IL-11 Protein, Human

IL-11 Protein, Human

Cat. No.: HY-P7031
COA Handling Instructions

IL-11 Protein, Human is a protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
10 μg $190 Ask For Quote & Lead Time
50 μg $620 Ask For Quote & Lead Time
100 μg $1050 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-11 Protein, Human is a protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.

Background

Recombinant Human Interleukin-11 (IL-11) plays a very crucial role in inflammation. Being an essential cytokine, IL-11 promotes chronic gastric inflammation and also associated with STAT3 and STAT1 mediated tumorigenesis. In addition, IL-11 is also an indispensable factor in IL-13- induced Th2-mediated inflammatory disorders and tissue remodeling. IL-11 has diverse biological functions. It has a protective role against neutron radiation injury, capable of promoting a faster recovery of small intestine injuries and also functions in response to inflammation in animal models of infection. Studies have revealed that IL-11 protects animal models of sepsis from liver injuries. Although its role in platelet production in neonates remains unclear, IL-11 is reported to be involved in the endogenous cytokine response to sepsis or Necrotizing Enterocolitis (NEC) in premmies. IL-11 is also involved in NF-κB signaling pathway and inhibition of IL-6 can reduce colitis associated tumorigenesis [1].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P20809 (P22-L199)

Gene ID
Molecular Construction
N-term
IL-11 (P22-L199)
Accession # P20809
C-term
Synonyms
rHuIL-11; Adipogenesis inhibitory factor; AGIF
AA Sequence

MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Weight

Approximately 19.1 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-11 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-11 Protein, Human
Cat. No.:
HY-P7031
Quantity:
MCE Japan Authorized Agent: