IL-12 Protein, Human (HEK293)

IL-12 Protein, Human (HEK293) is a HEK293 cell derived heterodimeric, pro-inflammatory cytokine.

Recombinant human IL-12 (hIL-12) is from the serum-free supernatants of stable IL-12-transduced HEK293 cells. Interleukin-12 is a heterodimeric, pro-inflammatory cytokine that is a key driver of cell-mediated immunity. Interleukin-12 (IL-12), previously known as natural killer cell stimulatory factor (NKSF) and cytotoxic lymphocyte maturation factor (CLMF), is a heterodimeric cytokine comprised of p40 and p35 subunits linked by an inter-subunit disulfide bridge. Among its many pleiotropic functions, IL-12 has been shown to induce: (i) IFNγ production; (ii) proliferation of activated T and NK cells; and (iii) T_H1 differentiation. These functions are mediated by binding of intact IL-12 to its heterodimeric transmembrane receptor complex consisting of two chains, IL-12Rβ1 and IL-12Rβ2^[1].

Measured in a cell proliferation assay using CTLL-2 cells. The ED₅₀ for this effect is 0.2209 ng/mL, corresponding to a specific activity is 4.53×10^6 units/mg.

• 
  Measured in a cell proliferation assay using CTLL-2 cells. The ED₅₀ for this effect is 0.2209 ng/mL, corresponding to a specific activity is 4.53×10⁶ units/mg.

Human

HEK293

Tag Free

P29459 (R23-S219) & P29460 (I23-S328)

3592  [NCBI]&3593  [NCBI]

RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Approximately 32&44 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jayanthi S, et al. Efficient production and purification of recombinant human interleukin-12 (IL-12) overexpressed in mammalian cells without affinity tag. Protein Expr Purif. 2014 Oct;102:76-84.  [Content Brief]