1. Recombinant Proteins
  2. IL-12 Protein, Human (HEK293)

IL-12 Protein, Human (HEK293)

Cat. No.: HY-P7032
Handling Instructions

IL-12 Protein, Human (HEK293) is a HEK293 cell derived heterodimeric, pro-inflammatory cytokine.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-12; NKSF; CTL maturation factor (TCMF); Cytotoxic lymphocyte maturation factor (CLMF)
Species

Human

Source

HEK 293

Accession

P29459 (R23-S219)&P29460 (I23-S328)

Gene ID

3592

Molecular Weight

Approximately 75 kDa

AA Sequence

p35
Subunit:<br>
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS<br>p40
Subunit:<br>I

Biological Activity
The ED50 is <2 ng/mL as measured by NK cells, corresponding to a specific activity of >5 ×105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant human IL-12 (hIL-12) is from the serum-free supernatants of stable IL-12-transduced HEK293 cells. Interleukin-12 is a heterodimeric, pro-inflammatory cytokine that is a key driver of cell-mediated immunity. Interleukin-12 (IL-12), previously known as natural killer cell stimulatory factor (NKSF) and cytotoxic lymphocyte maturation factor (CLMF), is a heterodimeric cytokine comprised of p40 and p35 subunits linked by an inter-subunit disulfide bridge. Among its many pleiotropic functions, IL-12 has been shown to induce: (i) IFNγ production; (ii) proliferation of activated T and NK cells; and (iii) TH1 differentiation. These functions are mediated by binding of intact IL-12 to its heterodimeric transmembrane receptor complex consisting of two chains, IL-12Rβ1 and IL-12Rβ2[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 Protein, Human (HEK293)
Cat. No.:
HY-P7032
Quantity:
MCE Japan Authorized Agent: