Copy Link Print Information

IL-12 Protein, Human (HEK293)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

IL-12 Protein, Human (HEK293) is a HEK293 cell derived heterodimeric, pro-inflammatory cytokine.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-12 Protein, Human (HEK293)
  • Experimental Validation Results for IL-12 Protein, Human (HEK293)
  • Experimental Validation Results for IL-12 Protein, Human (HEK293)
  • IL-12 Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-12 Protein, Human (HEK293) is a HEK293 cell derived heterodimeric, pro-inflammatory cytokine.

Background

Recombinant human IL-12 (hIL-12) is from the serum-free supernatants of stable IL-12-transduced HEK293 cells. Interleukin-12 is a heterodimeric, pro-inflammatory cytokine that is a key driver of cell-mediated immunity. Interleukin-12 (IL-12), previously known as natural killer cell stimulatory factor (NKSF) and cytotoxic lymphocyte maturation factor (CLMF), is a heterodimeric cytokine comprised of p40 and p35 subunits linked by an inter-subunit disulfide bridge. Among its many pleiotropic functions, IL-12 has been shown to induce: (i) IFNγ production; (ii) proliferation of activated T and NK cells; and (iii) TH1 differentiation. These functions are mediated by binding of intact IL-12 to its heterodimeric transmembrane receptor complex consisting of two chains, IL-12Rβ1 and IL-12Rβ2[1].

Verified Bioactivity

Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effects is < 2.0 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    P29459 (R23-S219)&P29460 (I23-S328)

  • Gene ID
    3592  [NCBI]&3593  [NCBI]
  • Molecular Construction
    • N-term
    • IL12A (R23-S219)
      Accession # P29459
    • C-term
    • N-term
    • IL12B (I23-S328)
      Accession # P29460
    • C-term
  • Synonyms

    IL12A; Cytotoxic Lymphocyte Maturation Factor 1, P35; Prev. NKSF1; NK Cell Stimulatory Factor Chain 1; IL-12A; Interleukin-12 Alpha Chain; Interleukin-12 Subunit Alpha; Interleukin 12, P35; CLMF; IL-12, Subunit P35; NFSK; IL35 Subunit; P35; CLMF P35; Inte

  • AA Sequence

    RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

  • Predicted Molecular Mass

    22.5 kDa & 34.7 kDa

  • Molecular Weight

    Approximately 25-38 kDa & 40-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Jayanthi S, et al. Efficient production and purification of recombinant human interleukin-12 (IL-12) overexpressed in mammalian cells without affinity tag. Protein Expr Purif. 2014 Oct;102:76-84. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the induction of lFN-y from NK92 cells. The ED50for this effect is 0.6937 ng/mL, corresponding to a specificactivity is 1.442×106 U/mg.

  • 1/16

    IL-12 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Int J Mol Sci. 2025 Mar 30;26(7):3211. [Abstract]

    Customer Validation
     Changes in Gzmb protein expression levels in NC and Thy1-OE NK92 cells after stimulation with IL-12 (50 ng/mL), IL-15 (50 ng/mL), and IL-18 (100 ng/mL) for 24 hours.

  • IL-12 Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for IL-12 Protein, Human (HEK293)
  • Experimental Validation Results for IL-12 Protein, Human (HEK293)
  • Experimental Validation Results for IL-12 Protein, Human (HEK293)
  • IL-12 Protein, Human (HEK293) Product Image