1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-12
  5. IL-12 Protein, Human (HEK293)

IL-12 Protein, Human (HEK293)

Cat. No.: HY-P7032
Handling Instructions

IL-12 Protein, Human (HEK293) is a HEK293 cell derived heterodimeric, pro-inflammatory cytokine.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-12 Protein, Human (HEK293) is a HEK293 cell derived heterodimeric, pro-inflammatory cytokine.

Background

Recombinant human IL-12 (hIL-12) is from the serum-free supernatants of stable IL-12-transduced HEK293 cells. Interleukin-12 is a heterodimeric, pro-inflammatory cytokine that is a key driver of cell-mediated immunity. Interleukin-12 (IL-12), previously known as natural killer cell stimulatory factor (NKSF) and cytotoxic lymphocyte maturation factor (CLMF), is a heterodimeric cytokine comprised of p40 and p35 subunits linked by an inter-subunit disulfide bridge. Among its many pleiotropic functions, IL-12 has been shown to induce: (i) IFNγ production; (ii) proliferation of activated T and NK cells; and (iii) TH1 differentiation. These functions are mediated by binding of intact IL-12 to its heterodimeric transmembrane receptor complex consisting of two chains, IL-12Rβ1 and IL-12Rβ2[1].

Biological Activity
The ED50 is <2 ng/mL as measured by NK cells, corresponding to a specific activity of >5 ×105 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

P29459 (R23-S219)&P29460 (I23-S328)

Gene ID
Synonyms
IL-12; Interleukin 12; Interleukin-12 subunit alpha; IL-12A; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35; IL-12 subunit p35; Interleukin-12 subunit beta; IL-12B; Cytotoxic lymphocyte maturation factor 40 kDa subunit; CLMF p40; IL-12 subunit p40
AA Sequence

RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Molecular Weight

Approximately 75 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-12 Protein, Human (HEK293) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 Protein, Human (HEK293)
Cat. No.:
HY-P7032
Quantity:
MCE Japan Authorized Agent: