Copy Link Print Information

IL-13 Protein, Human (HEK293, His)

29 Cited Publications
Customer Review

Based on 29 publication(s) in Google Scholar

IL-13 Protein, Human (HEK293, His) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, His) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with a His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • IL-13 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-13 Protein, Human (HEK293, His) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, His) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with a His tag.

Background

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. Interleukin- 13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation, Ig class switching to IgE synthesis, and enhanced production of IgG4 and IgM. In human macrophages and monocytes,hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1].

Verified Bioactivity

1. The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.7429-8.61 ng/mL.
2. Loaded Lebrikizumab (HY-P99025) on AHC2 biosensor, can bind IL-13 Protein, Human (HEK293, His) with an affinity constant of 7.283E-10 M as determined in BLI assay.
3. Loaded IL-13 Protein, Human (HEK293, His) on NTA biosensor, can bind Lunsekimig (HY-P990748) with an affinity constant of 2.806E-09 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P35225/AAH96139 (G35-N146)

  • Gene ID
    3596  [NCBI]
  • Molecular Construction
    • N-term
    • IL-13 (G35-N146)
      Accession # P35225/AAH96139
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788

  • AA Sequence

    GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

  • Molecular Weight

    Approximately 13-38 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12(2):239-48. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cell.The ED50 for this effect is 6.27 ng/mL, corresponding to a specific activity is 1.59×105 U/mg.

  • 1/16

    MedChemExpress Validation
     Loaded Lebrikizumab (HY-P99025) on AHC2 biosensor, can bind IL-13 Protein, Human (HEK293, His) with an affinity constant of 7.283E-10 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded IL-13 Protein, Human (HEK293, His) on NTA biosensor, can bind Lunsekimig (HY-P990748) with an affinity constant of 2.806E-09 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded Tilrekimig (HY-P991162) on ProA biosensor, can bind IL-13 Protein, Human (HEK293, His) with an affinity constant of 1.917E-09 M as determined in BLI assay.

  • 1/16

    IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Ethnopharmacol. 2026 Feb 10:356:120859. [Abstract]

    Customer Validation
     IL-13, Human (HEK293, His) (10 ng/mL; 12-36 h). Expression levels of the key protein STIM1 detected by western blotting in BEAS-2B cells treated with various concentrations of LPS combined with IL-13 at three different time points, used to select the optimal modeling dose and treatment duration.

  • 1/16

    IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 13:165:115485. [Abstract]

    Customer Validation
     IL-13, Human (HEK293, His) (20 ng/mL; 48 h). THP-1 monocytes were induced with PMA for 48 h to obtain M0 macrophages, followed by the addition of IL-4 and IL-13 for 48 h to induce polarization of M0 macrophages towards M2 macrophages. Flow cytometry analysis of CD163 expression levels in M0 macrophage and M2 macrophage.

  • 1/16

    IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Customer Validation
     Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h

  • 1/16

    IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2025 Feb 28;25(1):97. [Abstract]

    Customer Validation
     IL-13, Human (HEK293, His) (5 ng/mL; 48 h). IL-4 and IL-13 induce the differentiation of M0 macrophages into M2 macrophages.

  • 1/16

    IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cell Biosci. 2023 Aug 21;13(1):154. [Abstract]

    Customer Validation
     IL-13, Human (HEK293, His) (20 ng/mL; 24–48 h). Differentiated THP-1 cells were stimulated with LPS + IFNγ or IL-4 + IL-13 and treated with NC or PGAM5-siRNA for 24–48 h. a–d Levels of TNF-α (a), IL-1β (b), IL-6 (c), and IL-10 (d) secreted into the culture medium.

  • 1/16

    IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Immunol. 2023 Oct:162:74-83. [Abstract]

    Customer Validation
     IL-13, Human (HEK293, His) (2-50  ng/mL; 24 -72  h). IL-13 treatment induces inflammatory damagein bronchial epithelial cells.(A) The BEAS-2B cells were treated with IL-13 at different concentrations (2, 10 and 50 ng/ml) for 24 h, 48 h and 72 h. The effect of IL-13 on cell viability was detected by CCK-8 assays.

  • IL-13 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-13 Protein, Human (HEK293, His)
  • IL-13 Protein, Human (HEK293, His) Product Image

  • IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Ethnopharmacol. 2026 Feb 10:356:120859. [Abstract]

    IL-13, Human (HEK293, His) (10 ng/mL; 12-36 h). Expression levels of the key protein STIM1 detected by western blotting in BEAS-2B cells treated with various concentrations of LPS combined with IL-13 at three different time points, used to select the optimal modeling dose and treatment duration.

  • IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 13:165:115485. [Abstract]

    IL-13, Human (HEK293, His) (20 ng/mL; 48 h). THP-1 monocytes were induced with PMA for 48 h to obtain M0 macrophages, followed by the addition of IL-4 and IL-13 for 48 h to induce polarization of M0 macrophages towards M2 macrophages. Flow cytometry analysis of CD163 expression levels in M0 macrophage and M2 macrophage.

  • IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]

    Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h

  • IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2025 Feb 28;25(1):97. [Abstract]

    IL-13, Human (HEK293, His) (5 ng/mL; 48 h). IL-4 and IL-13 induce the differentiation of M0 macrophages into M2 macrophages.

  • IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cell Biosci. 2023 Aug 21;13(1):154. [Abstract]

    IL-13, Human (HEK293, His) (20 ng/mL; 24–48 h). Differentiated THP-1 cells were stimulated with LPS + IFNγ or IL-4 + IL-13 and treated with NC or PGAM5-siRNA for 24–48 h. a–d Levels of TNF-α (a), IL-1β (b), IL-6 (c), and IL-10 (d) secreted into the culture medium.

  • IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Immunol. 2023 Oct:162:74-83. [Abstract]

    IL-13, Human (HEK293, His) (2-50  ng/mL; 24 -72  h). IL-13 treatment induces inflammatory damagein bronchial epithelial cells.(A) The BEAS-2B cells were treated with IL-13 at different concentrations (2, 10 and 50 ng/ml) for 24 h, 48 h and 72 h. The effect of IL-13 on cell viability was detected by CCK-8 assays.