1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17C
  6. IL-17C Protein, Human (HEK293, His)

IL-17C Protein, Human (HEK293, His)

Cat. No.: HY-P72587
COA Handling Instructions

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections. IL-17C Protein, Human (HEK293, His) is a recombinant human IL-17C protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 179 amino acids (H19-V197).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $145 In-stock
50 μg $378 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections[1]. IL-17C Protein, Human (HEK293, His) is a recombinant human IL-17C protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 179 amino acids (H19-V197).

Background

Interleukin-17C (IL-17C) belongs to the IL-17 cytokine family. IL-17C is predominantly expressed by epithelial cells.
Human and mouse IL-17C shares 76.68% sequence identity.
IL-17C binds to its functional receptor, a heterodimer formed by IL-17RA and IL-17RE. TLR2, TLR3 and TLR5 upregulate the expression of IL-17C at mucosal surfaces. The expression of IL-17C is also regulated by cytokines (TNF-α, IL-1β and IL-17A). IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides including human beta-defensin 2 (hBD2), Lipocalin 2 (LCN2), and granzyme B. IL-17C also stimulates the release of cytokines (IL-1β, TNF-α, and IL-6).
IL-17C is implicated in autoimmune disorders and bacterial infections[1].

In Vitro

IL-17C is abundantly expressed in inflamed skin[2].
IL-17C (100 ng/mL; 16 h) potentiates TNF-α effects and mediates immune cell recruitment by induction of chemokines in keratinocytes[2].
IL-17C (200 ng/mL; 24 h) and TNF-α (2 ng/mL) induce characteristic psoriasis-related transcriptome genes in both additive and synergistic manners. IL-17C (6 h) increases mRNA expression of TNF-α and IL-6[3].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9P0M4 (H19-V197)

Gene ID
Molecular Construction
N-term
IL-17C (H19-V197)
Accession # Q9P0M4
6*His
C-term
Synonyms
CX2; Cytokine CX2; IL17C; Interleukin-17C
AA Sequence

HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Molecular Weight

Approximately 19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-17C Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17C Protein, Human (HEK293, His)
Cat. No.:
HY-P72587
Quantity:
MCE Japan Authorized Agent: