1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-38
  5. IL-1F10/IL-38 Protein, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Background

IL-1F10/IL-38 Protein is a secreted cytokine belonging to the IL-1 family that has immunomodulatory activity. IL-1F10/IL-38 Protein alone does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. IL-1F10/IL-38 Protein reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. IL-1F10/IL-38 Protein increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2[3][4].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

AAI03967.1 (M1-W152)

Gene ID
Molecular Construction
N-term
IL-38 (M1-W152)
Accession # AAI03967.1
C-term
Protein Length

Full Length

Synonyms
Interleukin-1 Family Member 10; IL-1F10; IL-1HY2; IL-1 Theta; IL1F10; FIL1T; IL-38
AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Weight

Approximately 17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-1F10/IL-38 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1F10/IL-38 Protein, Human
Cat. No.:
HY-P72570
Quantity:
MCE Japan Authorized Agent: