1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors B Cell CD Proteins NK Cell CD Proteins Cytokine Receptors
  4. IL-21R
  5. IL-21R Protein, Human (HEK293, Fc)

IL-21R protein, a receptor for interleukin-21, forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Human (HEK293, Fc) is the recombinant human-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-21R protein, a receptor for interleukin-21, forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Human (HEK293, Fc) is the recombinant human-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The IL-21R protein serves as a receptor for interleukin-21. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). Through this interaction, the receptor facilitates the signaling cascade initiated by interleukin-21, a cytokine with diverse immunoregulatory functions. The formation of the IL-21R heterodimer and its association with JAK1 are pivotal steps in transducing the cellular responses triggered by interleukin-21, contributing to the regulation of immune processes and inflammatory pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. When immobilized Human IL-21 at 2 μg/mL (100μL/Well), can bind Human IL-21R with the EC50 of <62.4 ng/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9HBE5 (C20-P236)

Gene ID
Protein Length

Partial

Synonyms
IL-21 receptor; IL-21R; CD360; NILR
AA Sequence

CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNP

Molecular Weight

60-70 kDa

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-21R Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-21R Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77714
Quantity:
MCE Japan Authorized Agent: