IL-22R alpha 1 Protein, Human (HEK293, Fc)

IL-22R alpha 1 (IL22RA1) Protein is an IL-22 receptor. IL-22R alpha 1 Protein interacts with IL-22 to activate the JAK/STAT cascade thereby inhibits IL-22 mediated promotion of cell proliferation and anti-apoptosis. IL-22R alpha 1 Protein, Human (HEK293, Fc) is expressed by HEK 293 cells and has a transmembrane region (H16-T228) with a Fc tag at the C-terminus^[1].

IL-22R alpha 1 (IL22RA1) Protein is a single-pass type I membrane protein. IL-22R alpha 1 expresses in colon, liver, lung, pancreas and kidney. IL-22R alpha 1 is primarily present on epithelial cells and certain monocyte subsets, and very limited IL-22R alpha 1 expression is found on other immune cells^[1][2].
The sequence of amino acids in IL-22R alpha 1 from different species is very different (less than 85% similarity among human, rat and Canine).
IL-22R alpha 1 is an essential component of the high-affinity IL-22 receptor enabling IL-22 signaling via JAK/STAT pathways. IL-22R alpha 1 is a component of one of the receptors for IL-20 and IL-24 formed and signaling through STATs activation. IL-22R alpha 1 mediates IL-24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation^[2][3].

1.Immobilized Human IL-22, His Tag at 2 μg/mL (100 μL/Well) on the plate. Dose response curve for Human IL-22R alpha 1, hFc Tag with the EC₅₀ of 4-11.0 ng/mL determined by ELISA.
2.Immobilized Human IL-22R alpha 1, hFc Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Anti-IL-22R alpha 1 Antibody, hFc Tag with the EC₅₀ of 11.2-18.4 ng/mL determined by ELISA.
3. Immobilized Human IL-22, His Tag at 5 μg/mL (100 μL/Well) on the plate. Dose response curve for Human IL-22R alpha 1, hFc Tag with the EC₅₀ of 33.50 ng/mL determined by ELISA.
4. Immobilized Human IL-22R alpha 1, hFc Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Anti-IL-22R alpha 1 Antibody, hFc Avi Tag with the EC₅₀ of 16.7-34.0 ng/mL determined by ELISA.

Human

HEK293

C-hFc

Q8N6P7-1 (H16-T228)

58985  [NCBI]

Extracellular Domain

HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT

60-68 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH7.5 with 10% trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/baf3-cell.html  [Content Brief]

  [2]. Cui X, et, al. IL22 furthers malignant transformation of rat mesenchymal stem cells, possibly in association with IL22RA1/STAT3 signaling. Oncol Rep. 2019 Apr;41(4):2148-2158.  [Content Brief]

  [3]. Kragstrup TW, et, al. The IL-20 Cytokine Family in Rheumatoid Arthritis and Spondyloarthritis. Front Immunol. 2018 Sep 25;9:2226.  [Content Brief]

  [4]. Persaud L, et, al. Mechanism of Action and Applications of Interleukin 24 in Immunotherapy. Int J Mol Sci. 2016 Jun 2;17(6):869.  [Content Brief]