1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-25/IL-17E
  6. IL-25/IL-17E Protein, Human (Biotinylated, HEK293, His-Avi)

IL-25/IL-17E Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P701012
Handling Instructions Technical Support

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The cytokine Animal-Free IL-25/IL-17E, produced by various cells such as eosinophils, T-helper type 2 (Th2) cells, or epithelial cells, plays a crucial role in the internal safety of adaptive immune responses by regulating cytokine production. This cytokine promotes and augments T-helper type 2 responses both locally and systemically, acting through its receptor composed of IL17RA and IL17RB for signal transduction. Upon binding, Animal-Free IL-25 activates the JAK2-STAT5A pathway, leading to the secretion of type-2-associated cytokines, including IL4, IL9, and IL13. Additionally, it induces the release of IL8 and IL6 from eosinophils by simultaneously activating the MAPK and NF-kappa-B pathways. Notably, Animal-Free IL-25 inhibits the differentiation of T-helper (Th17) cells through the production of IL4, IL5, and IL13, contributing to its regulatory role in immune responses.

Biological Activity

Immobilized Human IL-17RB, His Tag at 5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human IL-25, His Tag with the EC50 of 48.1 ng/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q9H293-1 (Y33-G177)

Gene ID
Molecular Construction
N-term
IL-17E (Y33-G177)
Accession # Q9H293-1
8*His-Avi
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Conjugation

Biotin

Synonyms
IL-25; IL-17E; IL17E; Interleukin-17E; interleukin-25
AA Sequence

YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Predicted Molecular Mass
19.2 kDa
분자량

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-25/IL-17E Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-25/IL-17E Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P701012
수량:
MCE Japan Authorized Agent: