Copy Link Print Information

IL-25/IL-17E Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-25/IL-17E Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-25/IL-17E Protein, Human (HEK293, His)
  • IL-25/IL-17E Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The cytokine Animal-Free IL-25/IL-17E, produced by various cells such as eosinophils, T-helper type 2 (Th2) cells, or epithelial cells, plays a crucial role in the internal safety of adaptive immune responses by regulating cytokine production. This cytokine promotes and augments T-helper type 2 responses both locally and systemically, acting through its receptor composed of IL17RA and IL17RB for signal transduction. Upon binding, Animal-Free IL-25 activates the JAK2-STAT5A pathway, leading to the secretion of type-2-associated cytokines, including IL4, IL9, and IL13. Additionally, it induces the release of IL8 and IL6 from eosinophils by simultaneously activating the MAPK and NF-kappa-B pathways. Notably, Animal-Free IL-25 inhibits the differentiation of T-helper (Th17) cells through the production of IL4, IL5, and IL13, contributing to its regulatory role in immune responses.

Verified Bioactivity

Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 1.0-1.5 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 1.231 ng/mL, corresponding to a specific activity is 8.123×105 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9H293-1 (Y33-G177)

  • Gene ID
    64806  [NCBI]
  • Molecular Construction
    • N-term
    • IL-17E (Y33-G177)
      Accession # Q9H293-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IL25; IL-25; Prev. IL17E; Interleukin-25; IL-17E; Interleukin 17E; Interleukin 25; Interleukin-17E

  • AA Sequence

    YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

  • Predicted Molecular Mass

    17.8 kDa

  • Molecular Weight

    Approximately 20-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce CXCL1 secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 1.231 ng/mL, corresponding to a specific activity is 8.123×105 U/mg.

  • IL-25/IL-17E Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-25/IL-17E Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-25/IL-17E Protein, Human (HEK293, His)
  • IL-25/IL-17E Protein, Human (HEK293, His) Product Image