1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Cynomolgus (His)

IL-3 Protein, secreted by T-lymphocytes, mast cells, and osteoblastic cells, regulates hematopoiesis and activates basophils, eosinophils, and monocytes. It promotes neural cell proliferation, inhibits osteoclast differentiation, and activates JAK2-STAT5 signaling. IL-3 also activates PI3K/AKT and ERK pathways for cell survival during oxidative stress. IL-3 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-3 Protein, secreted by T-lymphocytes, mast cells, and osteoblastic cells, regulates hematopoiesis and activates basophils, eosinophils, and monocytes. It promotes neural cell proliferation, inhibits osteoclast differentiation, and activates JAK2-STAT5 signaling. IL-3 also activates PI3K/AKT and ERK pathways for cell survival during oxidative stress. IL-3 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-3 protein, expressed by E. coli , with N-His labeled tag.

Background

IL-3 Protein is a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, and it plays a vital role in regulating hematopoietic progenitor cell production and differentiation into specific cell lineages. Additionally, IL-3 stimulates the functional activation of mature basophils, eosinophils, and monocytes. It also has important functions in neural cell proliferation and survival, and it participates in maintaining bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. The biological effects of IL-3 are mediated through a receptor complex composed of the IL3RA subunit and the IL3RB signal transducing subunit, which leads to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Furthermore, in non-hematopoietic systems, IL-3 contributes to cell survival during oxidative stress by activating pathways involving PI3K/AKT and ERK.

Species

Cynomolgus

Source

E. coli

Tag

N-8*His

Accession

G7P877 (A20-Q143)

Gene ID

/

Molecular Construction
N-term
8*His
IL-3 (A20-Q143)
Accession # G7P877
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL3; IL-3; IL-3MGC79398; interleukin-3; MULTI-CSF; MCGF
AA Sequence

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNTSAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Predicted Molecular Mass
15.1 kDa
Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-3 Protein, Cynomolgus (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-3 Protein, Cynomolgus (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Cynomolgus (His)
Cat. No.:
HY-P700859
Quantity:
MCE Japan Authorized Agent: