IL-3 Protein, Cynomolgus (His)

IL-3 Protein, secreted by T-lymphocytes, mast cells, and osteoblastic cells, regulates hematopoiesis and activates basophils, eosinophils, and monocytes. It promotes neural cell proliferation, inhibits osteoclast differentiation, and activates JAK2-STAT5 signaling. IL-3 also activates PI3K/AKT and ERK pathways for cell survival during oxidative stress. IL-3 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-3 protein, expressed by E. coli , with N-His labeled tag.

IL-3 Protein is a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, and it plays a vital role in regulating hematopoietic progenitor cell production and differentiation into specific cell lineages. Additionally, IL-3 stimulates the functional activation of mature basophils, eosinophils, and monocytes. It also has important functions in neural cell proliferation and survival, and it participates in maintaining bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. The biological effects of IL-3 are mediated through a receptor complex composed of the IL3RA subunit and the IL3RB signal transducing subunit, which leads to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Furthermore, in non-hematopoietic systems, IL-3 contributes to cell survival during oxidative stress by activating pathways involving PI3K/AKT and ERK.

Cynomolgus

E. coli

N-8*His

G7P877 (A20-Q143)

/

Full Length of Mature Protein

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNTSAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.