Copy Link Print Information

IL-3 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-3 Protein, Human (HEK293, His) is a multipotent hematopoietic growth factor that can control blood formation. IL-3 Protein, Human (HEK293, His) is a recombinant human interleukin-3 (rhIL-3) expressed in HEK 293 cells with a His tag. rhIL-3 is also a weak inflammatory mediator. rhIL-3 can be used to improve states of hematopoietic failure.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-3 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-3 Protein, Human (HEK293, His)
  • IL-3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-3 Protein, Human (HEK293, His) is a multipotent hematopoietic growth factor that can control blood formation. IL-3 Protein, Human (HEK293, His) is a recombinant human interleukin-3 (rhIL-3) expressed in HEK 293 cells with a His tag. rhIL-3 is also a weak inflammatory mediator. rhIL-3 can be used to improve states of hematopoietic failure[1].

Background

IL-3 has growth- and differentiation inducing potential on cells of the erythroid, granulocyte-macrophage (GM), megacaryocyte, and mast-cell lineage in vitro.
In addition IL-3 enhances the function of mature myeloid effector cells by stimulating monocyte- and eosinophil-mediated phagocytosis and antibody-dependent cellular cytotoxicity (ADCC), monocyte M-CSF receptor expression, tumor necrosis factor (TNF) and M-CSF synthesis, and basophil production of intracellular histamine and its release in response to complement factor C5a.
Thus, IL-3 may serve as a recruitment factor for activated inflammatory cells in states of increased demand, rather than being a major regulatory element in steady-state hematopoiesis[1].

Verified Bioactivity

The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.3-1.5 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.9659 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P08700 (A20-F152)

  • Gene ID
    3562  [NCBI]
  • Molecular Construction
    • N-term
    • IL-3 (A20-F152)
      Accession # P08700
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I

  • AA Sequence

    APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

  • Predicted Molecular Mass

    16.1 kDa

  • Molecular Weight

    Approximately 17-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. A Lindemann, et al. Biologic effects of recombinant human interleukin-3 in vivo. J Clin Oncol. 1991 Dec;9(12):2120-7. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.9659 ng/mL.

  • IL-3 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-3 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-3 Protein, Human (HEK293, His)
  • IL-3 Protein, Human (HEK293, His) Product Image