1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Human (HEK293, His)

IL-3 Protein, Human (HEK293, His)

Cat. No.: HY-P70765
COA Handling Instructions

IL-3 Protein, Human (HEK293, His) is a multipotent hematopoietic growth factor that can control blood formation. IL-3 Protein, Human (HEK293, His) is a recombinant human interleukin-3 (rhIL-3) expressed in HEK 293 cells with a His tag. rhIL-3 is also a weak inflammatory mediator. rhIL-3 can be used to improve states of hematopoietic failure.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $150 In-stock
50 μg $450 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-3 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-3 Protein, Human (HEK293, His) is a multipotent hematopoietic growth factor that can control blood formation. IL-3 Protein, Human (HEK293, His) is a recombinant human interleukin-3 (rhIL-3) expressed in HEK 293 cells with a His tag. rhIL-3 is also a weak inflammatory mediator. rhIL-3 can be used to improve states of hematopoietic failure[1].

Background

IL-3 has growth- and differentiation inducing potential on cells of the erythroid, granulocyte-macrophage (GM), megacaryocyte, and mast-cell lineage in vitro.
In addition IL-3 enhances the function of mature myeloid effector cells by stimulating monocyte- and eosinophil-mediated phagocytosis and antibody-dependent cellular cytotoxicity (ADCC), monocyte M-CSF receptor expression, tumor necrosis factor (TNF) and M-CSF synthesis, and basophil production of intracellular histamine and its release in response to complement factor C5a.
Thus, IL-3 may serve as a recruitment factor for activated inflammatory cells in states of increased demand, rather than being a major regulatory element in steady-state hematopoiesis[1].

Biological Activity

The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.3-1.5 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P08700 (A20-F152)

Gene ID
Synonyms
Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Weight

17-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

IL-3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Human (HEK293, His)
Cat. No.:
HY-P70765
Quantity:
MCE Japan Authorized Agent: