1. Recombinant Proteins
  2. IL-3 Protein, Human (HEK293, His)

IL-3 Protein, Human (HEK293, His)

Cat. No.: HY-P70765
Handling Instructions

IL-3 Protein, Human (HEK293, His) is a multipotent hematopoietic growth factor that can control blood formation. IL-3 Protein, Human (HEK293, His) is a recombinant human interleukin-3 (rhIL-3) expressed in HEK 293 cells with a His tag. rhIL-3 is also a weak inflammatory mediator. rhIL-3 can be used to improve states of hematopoietic failure[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $150 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE IL-3 Protein, Human (HEK293, His)

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
Species

Human

Source

HEK 293

Accession

P08700 (A20-F152)

Gene ID

3562

Molecular Weight

17-30 kDa

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.3-1.5 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

IL-3 has growth- and differentiation inducing potential on cells of the erythroid, granulocyte-macrophage (GM), megacaryocyte, and mast-cell lineage in vitro.
In addition IL-3 enhances the function of mature myeloid effector cells by stimulating monocyte- and eosinophil-mediated phagocytosis and antibody-dependent cellular cytotoxicity (ADCC), monocyte M-CSF receptor expression, tumor necrosis factor (TNF) and M-CSF synthesis, and basophil production of intracellular histamine and its release in response to complement factor C5a.
Thus, IL-3 may serve as a recruitment factor for activated inflammatory cells in states of increased demand, rather than being a major regulatory element in steady-state hematopoiesis[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Human (HEK293, His)
Cat. No.:
HY-P70765
Quantity:
MCE Japan Authorized Agent: