1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-35
  5. IL-35 Protein, Human (HEK293, Fc)

IL-35 Protein, Human (HEK293, Fc)

Cat. No.: HY-P70338
SDS COA Handling Instructions

IL-35 protein plays a key role in immune regulation, forming IL-12 cytokine with IL12B or IL-35 cytokine with EBI3/IL27B. IL-12 modulates T cell and natural killer cell responses and induces interferon gamma production. IL-35 Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived IL-35 protein, expressed by HEK293 , with C-hFc labeled tag. IL-35 Protein, Human (HEK293, Fc), has molecular weight of 80-120 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-35 protein plays a key role in immune regulation, forming IL-12 cytokine with IL12B or IL-35 cytokine with EBI3/IL27B. IL-12 modulates T cell and natural killer cell responses and induces interferon gamma production. IL-35 Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived IL-35 protein, expressed by HEK293 , with C-hFc labeled tag. IL-35 Protein, Human (HEK293, Fc), has molecular weight of 80-120 kDa.

Background

IL-35 Protein plays a pivotal role in immune regulation, exhibiting versatility in its functions. It heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to create the IL-35 cytokine. IL-12, primarily produced by professional antigen-presenting cells such as B-cells, dendritic cells, macrophages, and granulocytes, serves as a crucial link between innate resistance and adaptive immunity, regulating T-cell and natural killer-cell responses while inducing interferon-gamma production and favoring the differentiation of T-helper 1 cells. Mechanistically, IL-12 exerts its effects through a receptor composed of IL12R1 and IL12R2 subunits, leading to tyrosine phosphorylation of cellular substrates and subsequent regulation of cytokine/growth factor responsive genes by recruited phosphorylated STAT4. In the context of IL-35, IL-35 contributes significantly to maintaining immune homeostasis in the liver microenvironment and functions as an immune-suppressive cytokine. Notably, IL-35 mediates its effects through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers, requiring the transcription factors STAT1 and STAT4 for signaling. Additionally, IL-35 interacts with NBR1, promoting IL-12 secretion. The IL-35 heterodimer with EBI3/IL27B, known as interleukin IL-35, is not disulfide-linked, distinguishing it from the disulfide-linked IL-12 heterodimer with IL12B.

Biological Activity

Measured in a cell proliferation assay using PHA-stimulated Jurkat human T-lymphocyte leukemia cells. The ED50 of this effect is 0.02969 ng/ml in the presence of 10 μg/mL PHA, corresponding to a specific activity is 3.37×10^7 units/mg.

  • Measured in a cell proliferation assay using PHA-stimulated Jurkat human T-lymphocyte leukemia cells. The ED50 of this effect is 0.02969 ng/mL in the presence of 10 μg/mL PHA, corresponding to a specific activity is 3.37×107 units/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P29459 (R23-S219)&Q14213 (R21-K229)

Gene ID
Molecular Construction
N-term
IL27B (R21-K229)
Accession # Q14213
C-term
N-term
IL12A (R23-S219)
Accession # P29459
hFc
C-term
Synonyms
rHuInterleukin 35/IL-35, Fc; Interleukin 35; IL35; hIL35
AA Sequence

RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Molecular Weight

80-120 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-35 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-35 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70338
Quantity:
MCE Japan Authorized Agent: