1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-36RA
  5. IL-36RN Protein, Human

IL-36RN Protein, Human

Cat. No.: HY-P71965
COA Handling Instructions

IL-36RN Protein, Human, a member of the interleukin 1 cytokine family, is a IL-36 receptor antagonist.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $130 In-stock
50 μg $360 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-36RN Protein, Human, a member of the interleukin 1 cytokine family, is a IL-36 receptor antagonist.

Background

IL-1F5 (IL-36RN) acts as a receptor antagonist of IL-1RL2 (IL-1Rrp2). It inhibits the multiple stimulatory effects induced by the agonists IL-1F6 (IL-36a), IL-1F8 (IL36b) and IL-1F9 (IL-36c) by preventing them from binding to this receptor. As with IL-1RN, IL-36RN fails to recruit IL-1RAcP on the cell surface. IL-36RN also downregulates inflammation through an interaction with the orphan receptor SIGIRR. Humans possessing a homozygous missense mutation in IL-36RN express low levels of an aberrant protein which has a lower affinity for IL-1RL2 than the wild-type[1].

Biological Activity

Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells and the ED50 is 47.1 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9UBH0 (V2-D155)

Gene ID
Molecular Construction
N-term
IL-36RN (V2-D155)
Accession # Q9UBH0
C-term
Synonyms
IL-36RA; IL-36Ra; Interleukin-36 Receptor Antagonist Protein; IL-1RP3; Interleukin-1; Interleukin-1 Family Member 5; IL-1F5; Interleukin-1-Like Protein 1; IL-1L1; IL36RN; FIL1D; IL1F5; IL1HY1; IL1RP3
AA Sequence

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36RN Protein, Human
Cat. No.:
HY-P71965
Quantity:
MCE Japan Authorized Agent: