IL-36RN Protein, Human
Based on 1 Customer Validation
IL-36RN Protein, Human, a member of the interleukin 1 cytokine family, is a IL-36 receptor antagonist.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
IL-36RN Protein, Human, a member of the interleukin 1 cytokine family, is a IL-36 receptor antagonist.
IL-1F5 (IL-36RN) acts as a receptor antagonist of IL-1RL2 (IL-1Rrp2). It inhibits the multiple stimulatory effects induced by the agonists IL-1F6 (IL-36a), IL-1F8 (IL36b) and IL-1F9 (IL-36c) by preventing them from binding to this receptor. As with IL-1RN, IL-36RN fails to recruit IL-1RAcP on the cell surface. IL-36RN also downregulates inflammation through an interaction with the orphan receptor SIGIRR. Humans possessing a homozygous missense mutation in IL-36RN express low levels of an aberrant protein which has a lower affinity for IL-1RL2 than the wild-type[1].
Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells and the ED50 is 47.1 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9UBH0 (V2-D155)
-
Molecular Construction
-
N-term
-
IL-36RN (V2-D155)
Accession # Q9UBH0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL36RN; IL-1ra Homolog 1; Prev. IL1F5; IL-36Ra; IL1HY1; IL-1F5 (IL-1HY1, FIL1-Delta, IL-1RP3, IL-1L1, IL-1-Delta); IL1RP3; IL1F5 (Canonical Product IL-1F5a); FIL1D; Family Of Interleukin 1-Delta; IL1L1; Interleukin-1 Family Member 5; Interleukin-1 Recepto
-
AA Sequence
VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
