1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Biotinylated Proteins
  3. CSF & Receptors Stem Cell CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. IL-3R alpha/CD123
  5. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi)

IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P72349
Handling Instructions

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 287 a.a., with molecular weight of 80-100 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 287 a.a., with molecular weight of 80-100 kDa.

Background

IL-3R alpha/CD123 Protein serves as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, exerting control over the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, it rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins, including JAK2 and PI3K. These activated pathways play a crucial role in signaling cell proliferation and differentiation. JAK2 activation further initiates a STAT5-mediated transcriptional program, contributing to the regulation of cellular functions. The receptor interacts with its ligand, IL3, and forms a heterodimer consisting of an alpha and a beta subunit. Notably, the beta subunit is shared among the receptors for IL3, IL5, and GM-CSF.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

P26951 (T19-R305)

Gene ID
Molecular Construction
N-term
IL-3Rα (T19-R305)
Accession # P26951
hFc-Avi
C-term
Synonyms
Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunitalpha; IL-3R-alpha; IL-3RA; CD123
AA Sequence

TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Molecular Weight

80-100 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P72349
Quantity:
MCE Japan Authorized Agent: