IL-4 Protein, Cynomolgus (HEK293, Fc)

IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived IL-4 protein, expressed by HEK293, with C-hFc labeled tag.

IL-4 protein plays a pivotal role in various B-cell activation processes and other cell types, acting as a costimulator for DNA synthesis. Additionally, it promotes the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of both IgE and IgG1. IL-4 also regulates the expression of CD23, the low affinity Fc receptor for IgE, on lymphocytes and monocytes. Furthermore, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus / Rhesus macaque IL 4 R alpha, His Tag at 5 μg/mL (100 μL/well) can bind Cynomolgus IL-4, Fc Tag with the EC₅₀ of 0.99 ng/ml.

Cynomolgus

HEK293

C-hFc

P79339-1 (H25-S153)

107130068

Full Length of Mature Protein

HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Approximately 46-50 kDa and 53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution of 51 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH7.5 with 10% trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.