IL-4 Protein, Cynomolgus (P.pastoris, His)
IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived IL-4 protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Cynomolgus
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived IL-4 protein, expressed by P. pastoris , with N-His labeled tag.
Background
IL-4 protein plays a pivotal role in various B-cell activation processes and other cell types, acting as a costimulator for DNA synthesis. Additionally, it promotes the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of both IgE and IgG1. IL-4 also regulates the expression of CD23, the low affinity Fc receptor for IgE, on lymphocytes and monocytes. Furthermore, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.
Technical Parameters
-
Species Cynomolgus
-
Source P. pastoris
-
Tag N-His
-
Accession
P79339-1 (H25-S153)
-
Molecular Construction
-
N-term
-
His
-
IL-4 (H25-S153)
Accession # P79339-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1
-
AA Sequence
HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
