1. Recombinant Proteins
  2. IL-4 Protein, Mouse (CHO)

IL-4 Protein, Mouse (CHO)

Cat. No.: HY-P7080
Handling Instructions

IL-4 Protein, Mouse (CHO) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuIL-4; BSF-1; Binetrakin; Lymphocyte stimulatory factor 1; Pitrakinra
Species

Mouse

Source

CHO

Accession

P07750 (H21-S140)

Gene ID

16189

Molecular Weight

Approximately 15 kDa

AA Sequence

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Biological Activity
The ED50 is <2 ng/mL as measured by murine HT-2 cells, corresponding to a specific activity of >5 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Mouse Interleukin 4 is a 20-kDa glycoprotein, synthesized by activated T lymphocytes and mast cells, which regulates the growth and/or differentiation of a broad spectrum of target cells of the immune system, including B and T lymphocytes, macrophages, and hematopoietic progenitor cells. Murine Interleukin 4 (IL-4) is a potent mediator of an immune response, affecting both the growth and differentiation of a wide variety of cells in the hematopoietic lineage. This cytokine is expressed by activated T lymphocytes and mast cells as a 20-kDa glycoprotein. The cDNA for IL-4 isinitially is solated by two laboratories, using expression vectors and screening for either a IgG-inducing factor or a mast cell growth factor. The derived amino acid sequence from the cDNA clones is used to predict a protein backbone for IL-4 of 14 kDa. This is consistent with the observation that N-glycanase treatment of natural IL-4, to remove N-linked carbohydrates, yields a protein core of 14 kDa. Initial experiments with deglycosylated native IL-4 and with deglycosylated recombinant IL-4, expressed initially in yeast as a heterogeneous, hyperglycosylated molecule, suggested that the carbohydrate modifications of IL-4 do not affect its ability to bind to receptor and to stimulate T and B cell growth[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-4 Protein, Mouse (CHO)
Cat. No.:
HY-P7080
Quantity:
MCE Japan Authorized Agent: