Copy Link Print Information

IL-4 Protein, Mouse (CHO)

54 Cited Publications
Customer Review

Based on 54 publication(s) in Google Scholar

IL-4 Protein, Mouse (CHO) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-4 Protein, Mouse (CHO)
  • Experimental Validation Results for IL-4 Protein, Mouse (CHO)
  • Experimental Validation Results for IL-4 Protein, Mouse (CHO)
  • IL-4 Protein, Mouse (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-4 Protein, Mouse (CHO) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Background

Mouse Interleukin 4 is a 20-kDa glycoprotein, synthesized by activated T lymphocytes and mast cells, which regulates the growth and/or differentiation of a broad spectrum of target cells of the immune system, including B and T lymphocytes, macrophages, and hematopoietic progenitor cells. Murine Interleukin 4 (IL-4) is a potent mediator of an immune response, affecting both the growth and differentiation of a wide variety of cells in the hematopoietic lineage. This cytokine is expressed by activated T lymphocytes and mast cells as a 20-kDa glycoprotein. The cDNA for IL-4 isinitially is solated by two laboratories, using expression vectors and screening for either a IgG-inducing factor or a mast cell growth factor. The derived amino acid sequence from the cDNA clones is used to predict a protein backbone for IL-4 of 14 kDa. This is consistent with the observation that N-glycanase treatment of natural IL-4, to remove N-linked carbohydrates, yields a protein core of 14 kDa. Initial experiments with deglycosylated native IL-4 and with deglycosylated recombinant IL-4, expressed initially in yeast as a heterogeneous, hyperglycosylated molecule, suggested that the carbohydrate modifications of IL-4 do not affect its ability to bind to receptor and to stimulate T and B cell growth[1].

Verified Bioactivity

The ED50 is <2 ng/mL as measured by murine HT-2 cells, corresponding to a specific activity of >5 × 105 units/mg.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag Tag Free
  • Accession

    P07750 (H21-S140)

  • Gene ID
    16189  [NCBI]
  • Molecular Construction
    • N-term
    • IL-4 (H21-S140)
      Accession # P07750
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1

  • AA Sequence

    HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

  • Molecular Weight

    Approximately 15-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Levine AD, et al. High level expression and refolding of mouse interleukin 4 synthesized in Escherichia coli. J Biol Chem. 1995 Mar 31;270(13):7445-52. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HT-2 mouse cells. The ED50 for this effect is 0.26 ng/mL, corresponding to a specific activity is 3.81×106 units/mg.

  • 1/16

    IL-4 Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 Dec 20. [Abstract]

    Customer Validation
     IL-4 (10 ng/mL, 24 h) to obtain M1 or M2 macrophages, respectively,Representative fluorescence images of lipid peroxidation detected by BODIPY-C11 in M1 and M2 macrophages treated with H2O2 and acid condition.

  • IL-4 Protein, Mouse (CHO) Product Image
    1/16
  • Experimental Validation Results for IL-4 Protein, Mouse (CHO)
  • Experimental Validation Results for IL-4 Protein, Mouse (CHO)
  • Experimental Validation Results for IL-4 Protein, Mouse (CHO)
  • IL-4 Protein, Mouse (CHO) Product Image

  • IL-4 Protein, Mouse (CHO) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 Dec 20. [Abstract]

    IL-4 (10 ng/mL, 24 h) to obtain M1 or M2 macrophages, respectively,Representative fluorescence images of lipid peroxidation detected by BODIPY-C11 in M1 and M2 macrophages treated with H2O2 and acid condition.