1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin/UBLs
  4. Interferon-Stimulated Gene 15 (ISG15)
  5. ISG15/UCRP Protein, Human (His)

ISG15/UCRP Protein, Human (His) is the recombinant human-derived ISG15/UCRP protein, expressed by E. coli, with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ISG15/UCRP Protein, Human (His) is the recombinant human-derived ISG15/UCRP protein, expressed by E. coli, with C-6*His labeled tag.

Background

ISG15/UCRP is a ubiquitin-like protein that plays a pivotal role in the innate immune response to viral infection, either through conjugation to target proteins (ISGylation) or as a free protein. ISGylation involves an enzymatic cascade mediated by E1, E2, and E3 enzymes, leading to the covalent attachment of ISG15 to lysine residues on target proteins such as IFIT1, MX1/MxA, and PPM1B. ISG15 modulates diverse cellular functions via ISGylation, including activation of EIF2AK2/PKR, inhibition of RIGI's antiviral signaling, and enhancement of EIF4E2's translation-suppressive activity. It exhibits broad-spectrum antiviral activity against both DNA and RNA viruses (e.g., influenza A, HIV-1, and Ebola virus) by disrupting viral budding or impairing viral protein functions. The secreted form of ISG15 acts as a cytokine, inducing NK cell proliferation, neutrophil chemotaxis, and ITGAL/ITGB2-mediated activation of SRC family kinases (e.g., LYN, HCK, FGR) to promote IFNG and IL10 secretion, contributing to antimycobacterial immunity.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

AAH09507.1 (G2-G157)

Gene ID
Molecular Construction
N-term
ISG15 (G2-G157)
Accession # AAH09507.1
6*His
C-term
Protein Length

Partial

Synonyms
rHuISG15/UCRP, His; Ubiquitin-Like Protein ISG15; Interferon-Induced 15 kDa Protein; Interferon-Induced 17 kDa Protein; IP17; Ubiquitin Cross-Reactive Protein; hUCRP; ISG15; G1P2; UCRP
AA Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Predicted Molecular Mass
18.1 kDa
Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ISG15/UCRP Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ISG15/UCRP Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ISG15/UCRP Protein, Human (His)
Cat. No.:
HY-P70149
Quantity:
MCE Japan Authorized Agent: