JAM-B/CD322 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

JAM-B/CD322 protein and JAM3 coordinate heterotypic cell interactions and regulate different processes. In the bone marrow, it retains hematopoietic stem cells on stromal cells and aids leukocyte extravasation by promoting transmigration, tethering, and rolling. JAM-B/CD322 Protein, Human (HEK293, His) is the recombinant human-derived JAM-B/CD322 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

JAM-B/CD322 protein and JAM3 coordinate heterotypic cell interactions and regulate different processes. In the bone marrow, it retains hematopoietic stem cells on stromal cells and aids leukocyte extravasation by promoting transmigration, tethering, and rolling. JAM-B/CD322 Protein, Human (HEK293, His) is the recombinant human-derived JAM-B/CD322 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

JAM-B/CD322 protein, a junctional adhesion protein, intricately orchestrates heterotypic cell-cell interactions with its corresponding receptor, JAM3, thereby regulating diverse cellular processes as substantiated by various studies. Its involvement in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow underscores its crucial role in this physiological context. Positioned on the surface of bone marrow stromal cells, JAM-B/CD322 contributes significantly to the retention of hematopoietic stem and progenitor cells expressing JAM3. Moreover, this protein assumes a central role in the extravasation of leukocytes by not only facilitating transmigration but also mediating tethering and rolling of leukocytes along the endothelium. The tethering and rolling processes are contingent upon the binding of JAM2 to the integrin alpha-4/beta-1. Beyond hematopoiesis, JAM-B/CD322 extends its influence to spermatogenesis, where interactions between JAM2 and JAM3 in Sertoli and germ cells respectively play a pivotal role in anchoring germ cells onto Sertoli cells and assembling cell polarity complexes during spermatid differentiation. Additionally, it functions as an inhibitory somatodendritic cue, preventing the myelination of non-axonal parts of neurons, contributes to myocyte fusion during myogenesis, and may also play a role in angiogenesis.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • JAM-A (F29-N236)
      Accession # P57087-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    JAM2; CD322; Prev. C21orf43; VEJAM; VE-JAM; JAM-IT/VE-JAM; JAM-B; CD322 Antigen; JAM-2; PRO245; Vascular Endothelial Junction-Associated Molecule; IBGC8; Junctional Adhesion Molecule B; Junctional Adhesion Molecule 2; JAMB

  • AA Sequence

    FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLN

  • Predicted Molecular Mass

    24.3 kDa

  • Molecular Weight

    Approximately 35-39 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00