JAM-B/CD322 Protein, Human (HEK293, His)

JAM-B/CD322 protein and JAM3 coordinate heterotypic cell interactions and regulate different processes. In the bone marrow, it retains hematopoietic stem cells on stromal cells and aids leukocyte extravasation by promoting transmigration, tethering, and rolling. JAM-B/CD322 Protein, Human (HEK293, His) is the recombinant human-derived JAM-B/CD322 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of JAM-B/CD322 Protein, Human (HEK293, His) is 208 a.a., with molecular weight of 35-39 kDa.

JAM-B/CD322 protein, a junctional adhesion protein, intricately orchestrates heterotypic cell-cell interactions with its corresponding receptor, JAM3, thereby regulating diverse cellular processes as substantiated by various studies. Its involvement in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow underscores its crucial role in this physiological context. Positioned on the surface of bone marrow stromal cells, JAM-B/CD322 contributes significantly to the retention of hematopoietic stem and progenitor cells expressing JAM3. Moreover, this protein assumes a central role in the extravasation of leukocytes by not only facilitating transmigration but also mediating tethering and rolling of leukocytes along the endothelium. The tethering and rolling processes are contingent upon the binding of JAM2 to the integrin alpha-4/beta-1. Beyond hematopoiesis, JAM-B/CD322 extends its influence to spermatogenesis, where interactions between JAM2 and JAM3 in Sertoli and germ cells respectively play a pivotal role in anchoring germ cells onto Sertoli cells and assembling cell polarity complexes during spermatid differentiation. Additionally, it functions as an inhibitory somatodendritic cue, preventing the myelination of non-axonal parts of neurons, contributes to myocyte fusion during myogenesis, and may also play a role in angiogenesis.

Human

HEK293

C-6*His

P57087 (F29-N236)

58494  [NCBI]

FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLN

35-39 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.