JAM-C/CD323 Protein, Mouse (HEK293, His)

JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag. The total length of JAM-C/CD323 Protein, Mouse (HEK293, His) is 212 a.a., with molecular weight of 30-35 kDa.

JAM-C/CD323 protein serves as a junctional adhesion molecule, engaging in heterotypic cell-cell interactions with its receptor JAM2 to modulate diverse cellular processes. It plays a pivotal role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. Additionally, JAM-C is central to leukocyte extravasation, facilitating transmigration through the endothelium. In spermatogenesis, it forms interactions between Sertoli and germ cells, crucial for anchoring germ cells onto Sertoli cells and establishing cell polarity during spermatid differentiation. Acting as a counter-receptor for ITGAM, JAM-C mediates leukocyte-platelet interactions and regulates the transepithelial migration of polymorphonuclear neutrophils. Furthermore, it plays roles in angiogenesis, cell migration regulation, myocyte fusion during myogenesis, and promotes chemotaxis of vascular endothelial cells, thereby stimulating angiogenesis. The multifaceted functions of JAM-C underscore its significance in various cellular and physiological processes.

Measured by its ability to inhibit the adhesion of Jurkat cells on immobilized Human JAM-2. The ED₅₀ for this effect is 0.3033 μg/mL in the presence of 0.2 µg/mL Human JAM-2, corresponding to a specific activity is 3.297×10³ units/mg.

Mouse

HEK293

C-6*His

Q9D8B7/NP_075766.1 (E30-N241)

83964  [NCBI]

EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN

Approximately 27-34 kDa due to the glycosylation

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.