JAM-C/CD323 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag.

Background

JAM-C/CD323 protein serves as a junctional adhesion molecule, engaging in heterotypic cell-cell interactions with its receptor JAM2 to modulate diverse cellular processes. It plays a pivotal role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. Additionally, JAM-C is central to leukocyte extravasation, facilitating transmigration through the endothelium. In spermatogenesis, it forms interactions between Sertoli and germ cells, crucial for anchoring germ cells onto Sertoli cells and establishing cell polarity during spermatid differentiation. Acting as a counter-receptor for ITGAM, JAM-C mediates leukocyte-platelet interactions and regulates the transepithelial migration of polymorphonuclear neutrophils. Furthermore, it plays roles in angiogenesis, cell migration regulation, myocyte fusion during myogenesis, and promotes chemotaxis of vascular endothelial cells, thereby stimulating angiogenesis. The multifaceted functions of JAM-C underscore its significance in various cellular and physiological processes.

Verified Bioactivity

Measured by its ability to inhibit the adhesion of Jurkat cells on immobilized Human JAM-2. The ED50 for this effect is 0.3033 μg/mL in the presence of 0.2 µg/mL Human JAM-2, corresponding to a specific activity is 3.297×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the adhesion of Jurkat cells on immobilized Human JAM-2. The ED50 for this effect is 0.3033 μg/mL in the presence of 0.2 µg/mL Human JAM-2, corresponding to a specific activity is 3.297×103 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • JAM-A (E30-N241)
      Accession # Q9D8B7/NP_075766.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    JAM3; Junctional Adhesion Molecule C; Junctional Adhesion Molecule 3; JAMC; JAM-C; JAM-2; JAM-3

  • AA Sequence

    EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00