1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Junctional Adhesion Molecule C (JAM-C)
  6. JAM-C/CD323 Protein, Mouse (HEK293, His)

JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag.

Background

JAM-C/CD323 protein serves as a junctional adhesion molecule, engaging in heterotypic cell-cell interactions with its receptor JAM2 to modulate diverse cellular processes. It plays a pivotal role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. Additionally, JAM-C is central to leukocyte extravasation, facilitating transmigration through the endothelium. In spermatogenesis, it forms interactions between Sertoli and germ cells, crucial for anchoring germ cells onto Sertoli cells and establishing cell polarity during spermatid differentiation. Acting as a counter-receptor for ITGAM, JAM-C mediates leukocyte-platelet interactions and regulates the transepithelial migration of polymorphonuclear neutrophils. Furthermore, it plays roles in angiogenesis, cell migration regulation, myocyte fusion during myogenesis, and promotes chemotaxis of vascular endothelial cells, thereby stimulating angiogenesis. The multifaceted functions of JAM-C underscore its significance in various cellular and physiological processes.

Biological Activity

Measured by its ability to inhibit the adhesion of Jurkat cells on immobilized Human JAM-2. The ED50 for this effect is 0.3033 μg/mL in the presence of 0.2 µg/mL Human JAM-2, corresponding to a specific activity is 3.297×103 units/mg.

  • Measured by its ability to inhibit the adhesion of Jurkat cells on immobilized Human JAM-2. The ED50 for this effect is 0.3033 μg/mL in the presence of 0.2 µg/mL Human JAM-2, corresponding to a specific activity is 3.297×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9D8B7/NP_075766.1 (E30-N241)

Gene ID
Molecular Construction
N-term
JAM-A (E30-N241)
Accession # Q9D8B7/NP_075766.1
His
C-term
Protein Length

Extracellular Domain

Synonyms
CD323; JAM-2; JAM3; JAMC; Junctional adhesion molecule C
AA Sequence

EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN

Molecular Weight

Approximately 27-34 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JAM-C/CD323 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73849
Quantity:
MCE Japan Authorized Agent: