1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-7 Protein, Human (HEK293, His, solution)

Kallikrein-7 Protein, Human (HEK293, His, solution)

Cat. No.: HY-P70163
COA Handling Instructions

Kallikrein-7 Protein (KLK7), a member of the tissue kallikrein family, is a first protease target of vaspin inhibited by classical serpin mechanism with high specificity in vitro. KLK7 cleaves human insulin in the A- and B-chain. KLK7 a serine protease with chymotrypsin-like activity which was involved in the regulated desquamation of terminally differentiated keratinocytes. KLK7 mediates the disruption of corneodesmosomes, the cell–cell adhesion junctions of corneocyites, by hydrolyzing the two mayor cadherins (corneodesmosin and desmocollin 1) in the extracellular region of these junctions. KLK7 overexpression and/or increased activity result in over-desquamation. Kallikrein-7 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-7 Protein, Human (HEK293, His, solution) is 230 a.a., with molecular weight of ~30.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-7 Protein (KLK7), a member of the tissue kallikrein family, is a first protease target of vaspin inhibited by classical serpin mechanism with high specificity in vitro. KLK7 cleaves human insulin in the A- and B-chain. KLK7 a serine protease with chymotrypsin-like activity which was involved in the regulated desquamation of terminally differentiated keratinocytes. KLK7 mediates the disruption of corneodesmosomes, the cell–cell adhesion junctions of corneocyites, by hydrolyzing the two mayor cadherins (corneodesmosin and desmocollin 1) in the extracellular region of these junctions. KLK7 overexpression and/or increased activity result in over-desquamation[1][2][3]. Kallikrein-7 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-7 Protein, Human (HEK293, His, solution) is 230 a.a., with molecular weight of ~30.0 kDa.

Background

The molecular mass of full-length mature KLK7 is predicted to be ∼25 kDa, and KLK7 has one predicted glycosylation site at 246NDT, which is located away from the KLK7 catalytic triad and substrate binding pocket[1].
KLK7 is a member of the tissue kallikrein family that comprises 15 chymotrypsin- or trypsin-like serine proteases in humans. KLK7 is predominantly expressed in the skin where it is involved in the desquamation process. Aberrant KLK7 activity is a major underlying pathogenic mechanism of inflammatory skin diseases such as psoriasis, acne rosacea and Netherton syndrome[1].
KLK7 is initially characterized as an enzyme implicated in the degradation of intercellular cohesive structures in the stratum corneum of stratified squamous epithelia, preceding desquamation in the skin. It catalyzes the degradation of desmosomes in the outermost layer of skin and permits cell shedding to take place at the skin surface. Overexpression of KLK7 in tumor cells has been reported to significantly enhance the invasive potential in intracranial malignancies and ovarian cancer cells. Thus, KLK7 can contribute to the degradation of extracellular matrices in oral squamous cell carcinoma (OSCC) tissues, promoting invasion of neoplastic cells locally and facilitating metastasis to regional lymph nodes[2].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH32005 (E23-H252)

Gene ID
Molecular Construction
N-term
Kallikrein-7 (E23-H252)
Accession # AAH32005
6*His
C-term
Synonyms
rHuKallikrein 7/KLK7, His ; Kallikrein-7; hK7; Serine Protease 6; Stratum Corneum Chymotryptic Enzyme; hSCCE; KLK7; PRSS6; SCCE
AA Sequence

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKH

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Kallikrein-7 Protein, Human (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-7 Protein, Human (HEK293, His, solution)
Cat. No.:
HY-P70163
Quantity:
MCE Japan Authorized Agent: