1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF family
  4. FGF
  5. KGF-2/FGF-10 Protein, Mouse

KGF-2/FGF-10 Protein, Mouse

Cat. No.: HY-P7170
Handling Instructions

KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

KGF-2/FGF-10 Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Accession

O35565 (S62-T209)

Gene ID

14165

Synonyms
rMuFGF-10; Keratinocyte growth factor-2; Fgf10
AA Sequence

SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

Molecular Weight

Approximately 17 kDa

Biological Activity
The ED50 is <10 ng/mL as measured by 4MBr-5 cells, corresponding to a specific activity of >1.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Mature mouse Fibroblast Growth Factor-10 (FGF10) shares 94% and 100% amino acid sequence identity with human and rat FGF10, respectively. The mitogenic and chemotactic properties of FGF10 are critical in many tissues during embryogenesis. FGF10 induces signaling through FGF R2 (IIIb) also contributes to the progression of pancreatic cancer[1]. FGF10 is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF-2/FGF-10 Protein, Mouse
Cat. No.:
HY-P7170
Quantity:
MCE Japan Authorized Agent: