LAMP1/CD107a Protein, Rat (HEK293, Fc)

The LAMP1/CD107a protein is a lysosomal membrane glycoprotein that plays critical roles in lysosomal biogenesis, pH regulation, autophagy, and cholesterol homeostasis. It critically regulates lysosomal lumen pH by inhibiting the proton channel TMEM175, optimizing lysosomal acidification for efficient hydrolase activity. LAMP1/CD107a Protein, Rat (HEK293, Fc) is the recombinant rat-derived LAMP1/CD107a protein, expressed by HEK293 , with C-hFc labeled tag. The total length of LAMP1/CD107a Protein, Rat (HEK293, Fc) is 350 a.a., with molecular weight of ~125 kDa.

LAMP1/CD107a protein, a lysosomal membrane glycoprotein, assumes a pivotal role in lysosome biogenesis, lysosomal pH regulation, autophagy, and cholesterol homeostasis. It acts as a crucial regulator of lysosomal lumen pH by directly inhibiting the proton channel TMEM175, promoting optimal lysosomal acidification for efficient hydrolase activity. Beyond its involvement in cellular homeostasis, LAMP1 contributes significantly to NK-cell cytotoxicity. Mechanistically, it participates in the movement of cytotoxic granules to the cell surface and the trafficking of perforin to the lytic granule, safeguarding NK-cells from degranulation-associated damage caused by their own cytotoxic granule content. Moreover, LAMP1 plays a role in presenting carbohydrate ligands to selectins. Interactions with proteins like ABCB9 and FURIN are essential, stabilizing ABCB9 and protecting it from lysosomal degradation, while also inhibiting the proton channel activity of TMEM175.

Rat

HEK293

C-hFc

P14562 (A22-N371)

25328  [NCBI]

APALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNN

Approximately 125 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.