Latexin Protein, Human (HEK293, Fc)

Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (HEK293, Fc) is the recombinant human-derived Latexin protein, expressed by HEK293 , with N-hFc labeled tag.

Latexin, a protein of significance, functions as a robust, hardly reversible, and non-competitive inhibitor targeting CPA1, CPA2, and CPA4. Its inhibitory prowess underscores its potential role in modulating the activity of carboxypeptidases, contributing to intricate cellular processes. Notably, Latexin may also partake in the regulation of inflammation, suggesting its involvement in broader physiological contexts beyond enzyme inhibition.

Human

HEK293

N-hFc

Q9BS40 (E2-E222)

56925  [NCBI]

Partial

EIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

Approximately 60-65 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.