Lefty-A/TGF-beta 4 Protein, Human (HEK 293, His)

For research use only. We do not sell to patients.

Size	Price	Stock
10 μg	$50	Ask For Quote & Lead Time
50 μg	$150	Ask For Quote & Lead Time

* Please select Quantity before adding items.

Synonyms	rHuLeft-right determination factor 2, His; Left-right determination factor 2; Endometrial bleeding-associated factor; Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; LEFTY2; EBAF; LEFTA; LEFTYA; TGFB4
Species	Human
Source	HEK 293
Accession	O00292 (F78-P366)
Gene ID	7044
Molecular Weight	45-50 kDa
AA Sequence	FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Purity	Greater than 90% as determined by reducing SDS-PAGE.
Biological Activity	Data is not available.
Appearance	Lyophilized powder.
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Data Sheet (235 KB) Handling Instructions (2659 KB)

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Product Name

Salutation

Applicant Name *

Email address *

Phone number *

Organization name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.