Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Lefty-A, or TGF-beta 4, plays a crucial role in determining left-right (L-R) asymmetry in mammalian organ systems. Its implication in endometrial bleeding suggests a potential role in reproductive processes, highlighting its significance beyond embryonic development. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is the recombinant human-derived Lefty-A/TGF-beta 4 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is 289 a.a., with molecular weight of ~46 kDa.

Lefty-A, also known as TGF-beta 4, is crucial for the determination of left-right (L-R) asymmetry in organ systems within mammals. Its involvement in endometrial bleeding suggests a potential role in reproductive processes, emphasizing its significance beyond embryonic development.

Human

HEK293

N-6*His

O00292 (F78-P366)

7044  [NCBI]

FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Approximately 46 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 4% Sucrose, 4% Mannitol, 0.1% Tween80, pH 6.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.