1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. TGF-beta Receptor
  5. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Cat. No.: HY-P70191
Handling Instructions Technical Support

Lefty-A/TGF-beta 4 Protein, Human is a secreted protein belonging to the transforming growth factor-beta (TGF-β) family, which plays an important role in the development of human left-right axis. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is a recombinant Lefty-A/TGF-β 4 protein expressed by HEK293 with an N-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Lefty-A/TGF-beta 4 Protein, Human is a secreted protein belonging to the transforming growth factor-beta (TGF-β) family, which plays an important role in the development of human left-right axis. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is a recombinant Lefty-A/TGF-β 4 protein expressed by HEK293 with an N-6*His tag[1][2][3][4][5].

Background

Left-right determination factors (LEFTY) are important members of the TGF-β protein superfamily, including LEFTY-1 and LEFTY-2 in mice, as well as LEFTY-A and LEFTY-B in humans. Lefty-A plays a crucial role in determining the left-right asymmetry of the human organ system. Additionally, Lefty-A is a Nodal signaling inhibitor. In undifferentiated human embryonic stem cells, its high expression is maintained by activating Smad2/3 through the Activin/Nodal pathway, and its expression rapidly decreases during differentiation. Its promoter contains binding sites for FoxH1 and Smad2/3, and there is cross-talk with the Wnt pathway to jointly regulate its expression. In addition, Lefty-A plays an important role in the process of renal fibrosis[1][2][3][4][5].

In Vitro

Lefty A Protein can inhibit the TGF-β1/Smad pathway to reduce TGF-β1/Smad-mediated apoptosis in renal tubular epithelial cells[4].

Biological Activity

1.Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 0.9733-2.015 μg/mL. 2.Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 1.805 μg/mL, corresponding to a specific activity is 554.017 units/mg.

  • Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 0.9733 μg/mL, corresponding to a specific activity is 1.027×103 units/mg.
Species

Human

Source

HEK293

Tag

N-6*His

Accession

O00292 (L22-K76) & O00292 (F78-P366)

Gene ID
Molecular Construction
N-term
Propeptide (L22-K76)-6*His
Lefty-A (F78-P366)
Accession # O00292
C-term
Synonyms
rHuLeft-right determination factor 2, His; Left-right determination factor 2; Endometrial bleeding-associated factor; Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; LEFTY2; EBAF; LEFTA; LEFTYA; TGFB4
AA Sequence

LTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKHHHHHH&FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Molecular Weight

45-50 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 4% Sucrose, 4% Mannitol, 0.1% Tween80, pH 6.0 or 20 mM His-HCl, 10% Trehalose, 4% Mannitol, 100 mM NaCl, 0.1% Tween 80, pH 5.5 or PBS, pH 7.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)
Cat. No.:
HY-P70191
Quantity:
MCE Japan Authorized Agent: