Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Lefty-A/TGF-beta 4 Protein, Human is a secreted protein belonging to the transforming growth factor-beta (TGF-β) family, which plays an important role in the development of human left-right axis. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is a recombinant Lefty-A/TGF-β 4 protein expressed by HEK293 with an N-6*His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Lefty-A/TGF-beta 4 Protein, Human is a secreted protein belonging to the transforming growth factor-beta (TGF-β) family, which plays an important role in the development of human left-right axis. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is a recombinant Lefty-A/TGF-β 4 protein expressed by HEK293 with an N-6*His tag[1][2][3][4][5].
Background
Left-right determination factors (LEFTY) are important members of the TGF-β protein superfamily, including LEFTY-1 and LEFTY-2 in mice, as well as LEFTY-A and LEFTY-B in humans. Lefty-A plays a crucial role in determining the left-right asymmetry of the human organ system. Additionally, Lefty-A is a Nodal signaling inhibitor. In undifferentiated human embryonic stem cells, its high expression is maintained by activating Smad2/3 through the Activin/Nodal pathway, and its expression rapidly decreases during differentiation. Its promoter contains binding sites for FoxH1 and Smad2/3, and there is cross-talk with the Wnt pathway to jointly regulate its expression. In addition, Lefty-A plays an important role in the process of renal fibrosis[1][2][3][4][5].
In Vitro
Lefty A Protein can inhibit the TGF-β1/Smad pathway to reduce TGF-β1/Smad-mediated apoptosis in renal tubular epithelial cells[4].
Verified Bioactivity
Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 0.5-3.0 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Molecular Construction
-
N-term
-
Propeptide (L22-K76)-6*His
-
Lefty-A (F78-P366)
Accession # O00292 -
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
LEFTY2; Left-Right Determination Factor A; Prev. TGFB4; Protein Lefty-2; Prev. EBAF; Protein Lefty-A; LEFTYA; TGF-Beta-4; LEFTA; Endometrial Bleeding Associated Factor (Left-Right Determination, Factor A; Transforming Growth Factor Beta Superfamily); Endo
-
AA Sequence
LTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKHHHHHH&FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
-
Predicted Molecular Mass
39.1 kDa
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 4M Urea, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM His-HCl, 10% trehalose, 4% mannitol, 100 mM NaCl, 0.1% Tween 80, pH 5.5.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (266 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kosaki K, et al. Characterization and mutation analysis of human LEFTY A and LEFTY B, homologues of murine genes implicated in left-right axis development. Am J Hum Genet. 1999 Mar;64(3):712-21. [Content Brief]
[2]. Yang YR, et al. LEFTY2 alleviates hepatic stellate cell activation and liver fibrosis by regulating the TGF-β1/Smad3 pathway. Mol Immunol. 2020 Oct;126:31-39. [Content Brief]
[3]. Besser D. Expression of nodal, lefty-a, and lefty-B in undifferentiated human embryonic stem cells requires activation of Smad2/3. J Biol Chem. 2004 Oct 22;279(43):45076-84. [Content Brief]
[4]. Zheng RP, et al. Lefty A protein inhibits TGF-β1-mediated apoptosis in human renal tubular epithelial cells. Mol Med Rep. 2013 Aug;8(2):621-5. [Content Brief]
[5]. Li Y, et al. Lefty A attenuates the TGF-beta1-induced epithelial to mesenchymal transition of human renal proximal epithelial tubular cells. Mol Cell Biochem. 2010 Jun;339(1-2):263-70. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
