Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
10 μg	$50	In-stock	Estimated Time of Arrival: December 31
50 μg	$150	In-stock	Estimated Time of Arrival: December 31
100 μg		Get quote
250 μg		Get quote

* Please select Quantity before adding items.

Species	Human
Source	HEK293
Tag	N-6*His
Accession	O00292 (F78-P366)
Gene ID	7044 [NCBI]
Synonyms	rHuLeft-right determination factor 2, His; Left-right determination factor 2; Endometrial bleeding-associated factor; Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; LEFTY2; EBAF; LEFTA; LEFTYA; TGFB4
AA Sequence	FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Molecular Weight	Approximately 46 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 4% Sucrose, 4% Mannitol, 0.1% Tween80, pH 6.0.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (234 KB) SDS (251 KB) COA (232 KB) Handling Instructions (2659 KB)

Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Active (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email address *

Phone number *

Organization name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.