LHPP Protein, Human (His-SUMO)
Based on 1 Customer Validation
LHPP Protein, a phosphatase, exhibits broad substrate specificity, efficiently hydrolyzing imidodiphosphate, 3-phosphohistidine, and 6-phospholysine. It can also hydrolyze inorganic diphosphate, albeit less efficiently. LHPP Protein, Human (His-SUMO) is the recombinant human-derived LHPP protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
LHPP Protein, a phosphatase, exhibits broad substrate specificity, efficiently hydrolyzing imidodiphosphate, 3-phosphohistidine, and 6-phospholysine. It can also hydrolyze inorganic diphosphate, albeit less efficiently. LHPP Protein, Human (His-SUMO) is the recombinant human-derived LHPP protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
LHPP Protein is a phosphatase with the capacity to hydrolyze imidodiphosphate, 3-phosphohistidine, and 6-phospholysine, showcasing broad substrate specificity. Additionally, it possesses the ability to hydrolyze inorganic diphosphate, albeit with lower efficiency.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q9H008-1 (M1-K270)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
LHPP (M1-K270)
Accession # Q9H008-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
LHPP; HDHD2B; Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase; HLHPP
-
AA Sequence
MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK
-
Predicted Molecular Mass
45.2 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
