1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Leukocyte Immunoglobin-like Receptors
  4. CD85e/LILRA3 Leukocyte Immunoglobulin Like Receptor A3
  5. LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi)

LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72393
Handling Instructions

LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA3/CD85e/ILT6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is 416 a.a., with molecular weight of 70-90 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA3/CD85e/ILT6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is 416 a.a., with molecular weight of 70-90 kDa.

Background

LILRA3/CD85e/ILT6 acts as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, although with reduced affinities compared to LILRB1 or LILRB2. This protein exhibits a high-affinity interaction with the surface of monocytes, resulting in the suppression of LPS-induced TNF-alpha production by monocytes.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

AAH28208.1 (G24-E439)

Gene ID
Molecular Construction
N-term
LILRA3 (G24-E439)
Accession # AAH28208.1
6*His-Avi
C-term
Synonyms
CD85 antigen-like family member E; ILT-6; LIR-4 and Monocyte inhibitory receptor HM43/HM31
AA Sequence

GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Molecular Weight

70-90 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72393
Quantity:
MCE Japan Authorized Agent: