Livin/BIRC7 Protein, Human (His)

Livin/BIRC7, an apoptotic regulator, orchestrates proapoptotic and anti-apoptotic activities, crucial for apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic function involves inhibiting CASP3, CASP7, and CASP9, alongside E3 ubiquitin-protein ligase activity. Despite being a weak caspase inhibitor, Livin's anti-apoptotic prowess arises from ubiquitinating DIABLO/SMAC, preventing its interference with XIAP/BIRC4-caspase interactions, ensuring cell survival. Livin shields against TNF or chemical-induced apoptosis through MAPK8/JNK1 activation, possibly aided by MAP3K7/TAK1 and TAB1. It inhibits CASP3, blocks pro-CASP9 activation, and promotes NK cell-mediated killing, highlighting its multifaceted regulatory roles. Livin/BIRC7 Protein, Human (His) is the recombinant human-derived Livin/BIRC7 protein, expressed by E. coli, with C-His labeled tag. The total length of Livin/BIRC7 Protein, Human (His) is 298 a.a., with molecular weight of ~35 kDa.

Livin/BIRC7, an apoptotic regulator, intricately modulates both proapoptotic and anti-apoptotic activities, holding pivotal roles in apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic prowess stems from the inhibition of CASP3, CASP7, and CASP9, coupled with its E3 ubiquitin-protein ligase activity. Despite its classification as a weak caspase inhibitor, Livin's anti-apoptotic function is attributed to its capability to ubiquitinate DIABLO/SMAC, directing it for degradation and thereby fostering cell survival. Furthermore, Livin may hinder DIABLO/SMAC from disrupting XIAP/BIRC4-caspase interactions, potentially contributing to caspase inhibition. Notably, Livin safeguards against apoptosis induced by TNF or chemical agents like adriamycin, etoposide, or staurosporine. This protective effect is facilitated through the activation of MAPK8/JNK1 and possibly MAPK9/JNK2, contingent upon TAB1 and MAP3K7/TAK1. Livin's multifaceted functions also extend to inhibiting CASP3 and impeding the proteolytic activation of pro-CASP9 in vitro, as well as blocking staurosporine-induced apoptosis. Moreover, Livin promotes natural killer (NK) cell-mediated killing, underscoring its diverse regulatory roles in cellular processes.

Measured by its ability to inhibit DEVD-AFC cleavage activity in cell extracts activated by addition of cytochrome c and dATP. The IC₅₀ value is 1.223 nM, as measured under the described conditions.

Human

E. coli

C-His

Q96CA5 (M1-S298)

79444  [NCBI]

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Approximately 35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris, 200 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.