LOX-1/OLR1 Protein, Cynomolgus (HEK293, His)

OLR1 is a type II membrane glycoprotein belonging to C-type lectin family with a short N-terminal cytoplasmic tail and a long C-terminal extracellular domain. OLR1 binds ox-LDL, delipidated, and solubilized ox-LDL. LOX-1/OLR1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

OLR1 is a type II membrane glycoprotein belonging to C-type lectin family with a short N-terminal cytoplasmic tail and a long C-terminal extracellular domain. OLR1 binds ox-LDL, delipidated, and solubilized ox-LDL. OLR1 enables low-density lipoprotein particle receptor activity. OLR1 is involved in cell death, inflammatory response, leukocyte cell-cell adhesion and lipoprotein metabolic process^[1][2].

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LOX-1 at 5 μg/mL (100 μL/well) can bind bovine AGE-BSA, The ED₅₀ for this effect is 0.849 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LOX-1 at 5 μg/mL (100 μL/well) can bind bovine AGE-BSA, The ED₅₀ for this effect is 0.849 μg/mL.

Cynomolgus

HEK293

N-6*His

G7PJT2 (S61-Q273)

/

Partial

SQVSNLLKQQQTNLTHQKNKLEGQISARQQAEEASQESQNELKEMIETLAWKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHEENCYLFSTGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRIRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Approximately 33 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.