1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. C Chemokines
  5. XCL1
  6. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His)

Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His)

Cat. No.: HY-P71434
Handling Instructions Technical Support

XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) is produced in HEK293 cells with six C-Terminal His-tags and a C-Terminal Fc-tag. It consists of 93 amino acids (V22-G114).

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases[1]. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) is produced in HEK293 cells with six C-Terminal His-tags and a C-Terminal Fc-tag. It consists of 93 amino acids (V22-G114).

Background

XCL1, also known as lymphotactin, single C motif-1 (SCM-1), and activation-induced T-cell-derived and chemokine-related molecule (ATAC). XCL1 is expressed by various immune cells, including activated CD8+ T cells, CD4+ T cells, NK cells, NKT cells, γδ T cells, and thymic medullary epithelial cells. XCL1 elicits its chemotactic function by binding to the receptor called XCR1. XCR1 is expressed by a dendritic cell (DC) subpopulation[1].
  There are two highly homologous C class chemokine genes in human, XCL1 and XCL2 (also known as SCYC1 and SCYC2, respectively). The XCL1 and XCL2 genes in human are localized closely on chromosome 1 and encode highly homologous proteins (also known as SCM-1K and SCM-1L, respectively) with only two amino acid differences from each other. Unlike CXC, CC, and CX3C class chemokines that carry two disulfide bonds with four cysteine residues at the amino termini, XCL1 has only one disulfide bond with two cysteine residues at the amino terminus. Human and mouse XCL1s share 60% amino acid identity. XCL1 transcripts are detected in spleen, thymus, intestine, and peripheral blood leukocytes. XCL1 expression is also detectable in lung, colon, prostate gland, testis, and ovary. In leukocytes, XCL1 is highly expressed in CD8+ and CD4-CD8- TCRαβ+ T cells in blood and thymus, particularly when the cells are activated. TCRαβ+ T cells in epidermis and intestinal epithelium also express XCL1[1].
XCL1 exerts chemotactic and immunomodulatory activity on T cells, natural killer (NK) cells, and macrophages. The interaction between XCL1 and XCR1 plays an important role in DC-mediated immune response and thymic development of regulatory T cells. It has been also shown that XCL1 and XCR1 are constitutively expressed in the thymus and regulate the thymic establishment of self-tolerance and the generation of regulatory T cells. The elevated expression of XCL1 in various infectious and autoimmune diseases suggests the role of the XCL1-XCR1 axis in protective and pathological immune responses. In addition, XCL1 plays a role in the development of arthritis and progressive bone degradation in rheumatoid arthritis[1][2].

In Vitro

Recombinant human XCL1 (10, 50, or 100 ng/mL; 48 hours) promotes osteoclastogenesis and the osteoclast-bone resorbing activity in human monocytes. Moreover, recombinant XCL1 promotes the expression of inflammatory and osteoclastogenic factors, including IL-6, IL-8, and RANKL in human differentiated osteoblasts[2].

In Vivo

Lei Y, et al. XCL1 and XCR1 in the immune system. Microbes Infect. 2012 Mar;14(3):262-7.

Species

Human

Source

HEK293

Tag

C-hFc;C-6*His

Accession

P47992 (V22-G114)

Gene ID
Molecular Construction
N-term
XCL1 (V22-G114)
Accession # P47992
hFc-6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Lymphotactin; ATAC; C motif chemokine 1; Cytokine SCM-1; Lymphotaxin; SCM-1-alpha; Small-inducible cytokine C1; XC chemokine ligand 1; LTN; SCYC1 and XCL1
AA Sequence

VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Predicted Molecular Mass
38.2 kDa
분자량

Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His)
Cat. No.:
HY-P71434
수량:
MCE Japan Authorized Agent: