1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Human (223a.a, HEK293, His)

M-CSF Protein, Human (223a.a, HEK293, His)

Cat. No.: HY-P70488
COA Handling Instructions

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (223a.a, HEK293, His) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of M-CSF Protein, Human (223a.a, HEK293, His) is 223 a.a., with molecular weight of ~41.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $90 In-stock
50 μg $260 In-stock
100 μg $442 In-stock
500 μg $1300 In-stock
1 mg $2300 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE M-CSF Protein, Human (223a.a, HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (223a.a, HEK293, His) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with C-6*His labeled tag. The total length of M-CSF Protein, Human (223a.a, HEK293, His) is 223 a.a., with molecular weight of ~41.0 kDa.

Background

M-CSF Protein is a vital cytokine involved in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. It plays a crucial role in innate immunity and inflammatory processes by promoting the release of pro-inflammatory chemokines. Additionally, M-CSF Protein is essential for osteoclast proliferation and differentiation, regulating bone resorption, and normal bone development. It is also necessary for normal male and female fertility. Moreover, M-CSF Protein contributes to the reorganization of the actin cytoskeleton, facilitating membrane ruffle formation, cell adhesion, and cell migration. Furthermore, it plays a role in lipoprotein clearance. M-CSF Protein can exist in different forms, such as homodimer or heterodimer configurations, and it interacts with CSF1R.

Biological Activity

Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.323 ng/mL, corresponding to a specific activity is 7.559×105 units/mg.

  • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.323 ng/mL, corresponding to a specific activity is 7.559×105 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P09603 (E33-R255)

Gene ID
Molecular Construction
N-term
M-CSF (E33-R255)
Accession # P09603
6*His
C-term
Synonyms
Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; MCSF; Lanimostim; CSF1
AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR

Molecular Weight

Approximately 41.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

M-CSF Protein, Human (223a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
M-CSF Protein, Human (223a.a, HEK293, His)
Cat. No.:
HY-P70488
Quantity:
MCE Japan Authorized Agent: