M-CSF Protein, Human (223a.a, HEK293, His)

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (223a.a, HEK293, His) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

M-CSF Protein is a vital cytokine involved in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. It plays a crucial role in innate immunity and inflammatory processes by promoting the release of pro-inflammatory chemokines. Additionally, M-CSF Protein is essential for osteoclast proliferation and differentiation, regulating bone resorption, and normal bone development. It is also necessary for normal male and female fertility. Moreover, M-CSF Protein contributes to the reorganization of the actin cytoskeleton, facilitating membrane ruffle formation, cell adhesion, and cell migration. Furthermore, it plays a role in lipoprotein clearance. M-CSF Protein can exist in different forms, such as homodimer or heterodimer configurations, and it interacts with CSF1R.

Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 2-10 ng/mL, corresponding to a specific activity is ≤6.69×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 1.323 ng/mL, corresponding to a specific activity is 7.559×10⁵ units/mg.

Human

HEK293

C-6*His

P09603-1 (E33-R255)

1435  [NCBI]

Partial

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR

Approximately 34-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 4% Mannitol, pH 7.2.
Please refer to the lot-specific COA for specific buffer information.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.