MBL2/COLEC1 Protein, Mouse (HEK293)

Customer Review

Based on 1 Customer Validation

C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein exerts mannose-binding, calcium-dependent protein binding and identical protein binding activity. MBL2/COLEC1 Protein, Mouse (HEK293) is the recombinant mouse-derived MBL2/COLEC1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein exerts mannose-binding, calcium-dependent protein binding and identical protein binding activity. MBL2/COLEC1 Protein, Mouse (HEK293) is the recombinant mouse-derived MBL2/COLEC1 protein, expressed by HEK293 , with tag free.

Background

C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. The binding activates the classical complement pathway. C-type lectin domain-containing protein also has calcium-dependent protein binding activity and identical protein binding activity. Deficiencies of C-type lectin domain-containing protein may have association with susceptibility to autoimmune, infectious, liver and lung diseases[1][2].

Verified Bioactivity

Immobilized Mannan at 50 μg/mL (100 μL/well) can bind Biotinylated Mouse MBL2 Protein. The ED50 for this effect is 3.112 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Mannan at 50 μg/mL (100 μL/well) can bind Biotinylated Mouse MBL2 Protein. The ED50 for this effect is 3.112 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MBL2/COLEC1 (E19-D244)
      Accession # Q3UEK1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    MBL2; Mannose-Binding Lectin (Protein C) 2, Soluble; Prev. MBL; Mannose-Binding Lectin; COLEC1; Mannan-Binding Protein; MBP-C; Mannose Binding Lectin; MBP1; Mannan-Binding Lectin; MBP; Collectin 1; Mannose-Binding Lectin (Protein C) 2, Soluble (Opsonic De

  • AA Sequence

    ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00