MBL2/COLEC1 Protein, Mouse (HEK293)
Based on 1 Customer Validation
C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein exerts mannose-binding, calcium-dependent protein binding and identical protein binding activity. MBL2/COLEC1 Protein, Mouse (HEK293) is the recombinant mouse-derived MBL2/COLEC1 protein, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein exerts mannose-binding, calcium-dependent protein binding and identical protein binding activity. MBL2/COLEC1 Protein, Mouse (HEK293) is the recombinant mouse-derived MBL2/COLEC1 protein, expressed by HEK293 , with tag free.
C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. The binding activates the classical complement pathway. C-type lectin domain-containing protein also has calcium-dependent protein binding activity and identical protein binding activity. Deficiencies of C-type lectin domain-containing protein may have association with susceptibility to autoimmune, infectious, liver and lung diseases[1][2].
Immobilized Mannan at 50 μg/mL (100 μL/well) can bind Biotinylated Mouse MBL2 Protein. The ED50 for this effect is 3.112 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
Q3UEK1 (E19-D244)
-
Molecular Construction
-
N-term
-
MBL2/COLEC1 (E19-D244)
Accession # Q3UEK1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MBL2; Mannose-Binding Lectin (Protein C) 2, Soluble; Prev. MBL; Mannose-Binding Lectin; COLEC1; Mannan-Binding Protein; MBP-C; Mannose Binding Lectin; MBP1; Mannan-Binding Lectin; MBP; Collectin 1; Mannose-Binding Lectin (Protein C) 2, Soluble (Opsonic De
-
AA Sequence
ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
