MBL2/COLEC1 Protein, Mouse (HEK293)

C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein exerts mannose-binding, calcium-dependent protein binding and identical protein binding activity. MBL2/COLEC1 Protein, Mouse (HEK293) is the recombinant mouse-derived MBL2/COLEC1 protein, expressed by HEK293, with tag free. The total length of MBL2/COLEC1 Protein, Mouse (HEK293) is 226 a.a., with molecular weight of ~28.0 kDa.

C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. The binding activates the classical complement pathway. C-type lectin domain-containing protein also has calcium-dependent protein binding activity and identical protein binding activity. Deficiencies of C-type lectin domain-containing protein may have association with susceptibility to autoimmune, infectious, liver and lung diseases^[1][2].

Mouse

HEK293

Tag Free

Q3UEK1 (E19-D244)

17195  [NCBI]

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Approximately 28.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.