MINPP1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The MINPP1 protein is a bifunctional phosphatase that regulates inositol pentaphosphate (InsP5) and phytate hexaphosphate (InsP6) levels through phosphoinositide 5- and phosphoinositide 6-phosphatase activities. It also acts as 2,3-bisphosphoglycerate 3-phosphatase, which is essential for bone development and chondrocyte transformation. MINPP1 Protein, Human (HEK293, His) is the recombinant human-derived MINPP1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MINPP1 protein is a bifunctional phosphatase that regulates inositol pentaphosphate (InsP5) and phytate hexaphosphate (InsP6) levels through phosphoinositide 5- and phosphoinositide 6-phosphatase activities. It also acts as 2,3-bisphosphoglycerate 3-phosphatase, which is essential for bone development and chondrocyte transformation. MINPP1 Protein, Human (HEK293, His) is the recombinant human-derived MINPP1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
MINPP1 Protein acts as a dual-function phosphatase, exhibiting phosphoinositide 5- and phosphoinositide 6-phosphatase activity to regulate cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Additionally, it functions as a 2,3-bisphosphoglycerate 3-phosphatase, catalyzing the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without the formation of 3-phosphoglycerate. These activities are crucial for cellular processes, including bone development, specifically in endochondral ossification, and may contribute to the transition of chondrocytes from proliferation to hypertrophy. By regulating intracellular inositol polyphosphates, MINPP1 plays a potential role in controlling intracellular cation homeostasis, impacting free cation availability required for neural cell signaling.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9UNW1 (S31-L487)
-
Molecular Construction
-
N-term
-
MINPP1 (S31-L487)
Accession # Q9UNW1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MINPP1; Inositol (1,3,4,5)-Tetrakisphosphate 3-Phosphatase; Multiple Inositol-Polyphosphate Phosphatase 1; Multiple Inositol Polyphosphate Phosphatase 2; MIPP; Ins(1,3,4,5)P(4) 3-Phosphatase; Multiple Inositol Polyphosphate Histidine Phosphatase, 1; HIPER
-
AA Sequence
SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL
-
Predicted Molecular Mass
53.1 kDa
-
Molecular Weight
Approximately 56 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
