1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. MINPP1 Protein, Human (HEK293, His)

MINPP1 Protein, Human (HEK293, His)

Cat. No.: HY-P70937
Handling Instructions

MINPP1 Protein, a dual-function phosphatase, regulates inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) levels through phosphoinositide 5- and phosphoinositide 6-phosphatase activity. It also acts as a 2,3-bisphosphoglycerate 3-phosphatase, crucial for bone development and chondrocyte transition. By controlling intracellular inositol polyphosphates, MINPP1 potentially influences cation homeostasis, impacting neural cell signaling through free cation availability. MINPP1 Protein, Human (HEK293, His) is the recombinant human-derived MINPP1 protein, expressed by HEK293, with C-6*His labeled tag. The total length of MINPP1 Protein, Human (HEK293, His) is 457 a.a., with molecular weight of ~56.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MINPP1 Protein, a dual-function phosphatase, regulates inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) levels through phosphoinositide 5- and phosphoinositide 6-phosphatase activity. It also acts as a 2,3-bisphosphoglycerate 3-phosphatase, crucial for bone development and chondrocyte transition. By controlling intracellular inositol polyphosphates, MINPP1 potentially influences cation homeostasis, impacting neural cell signaling through free cation availability. MINPP1 Protein, Human (HEK293, His) is the recombinant human-derived MINPP1 protein, expressed by HEK293, with C-6*His labeled tag. The total length of MINPP1 Protein, Human (HEK293, His) is 457 a.a., with molecular weight of ~56.0 kDa.

Background

MINPP1 Protein acts as a dual-function phosphatase, exhibiting phosphoinositide 5- and phosphoinositide 6-phosphatase activity to regulate cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Additionally, it functions as a 2,3-bisphosphoglycerate 3-phosphatase, catalyzing the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without the formation of 3-phosphoglycerate. These activities are crucial for cellular processes, including bone development, specifically in endochondral ossification, and may contribute to the transition of chondrocytes from proliferation to hypertrophy. By regulating intracellular inositol polyphosphates, MINPP1 plays a potential role in controlling intracellular cation homeostasis, impacting free cation availability required for neural cell signaling.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UNW1 (S31-L487)

Gene ID
Molecular Construction
N-term
MINPP1 (S31-L487)
Accession # Q9UNW1
6*His
C-term
Synonyms
Multiple Inositol Polyphosphate Phosphatase 1; 2,3-Bisphosphoglycerate 3-Phosphatase; 2,3-BPG Phosphatase; Inositol (1,3,4,5)-Tetrakisphosphate 3-Phosphatase; Ins(1,3,4,5)P(4) 3-Phosphatase; MINPP1; MIPP
AA Sequence

SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

Molecular Weight

Approximately 56.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MINPP1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MINPP1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70937
Quantity:
MCE Japan Authorized Agent: