1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Protein Tyrosine Kinases STE
  4. STE7
  5. MKK6/MAP2K6
  6. MKK6 Protein, Human (Active, S207D, T211D, sf9, His-GST)

MKK6 Protein, Human (Active, S207D, T211D, sf9, His-GST)

Cat. No.: HY-P73811
Handling Instructions Technical Support

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His-GST) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The MKK6 protein is a dual-specificity kinase involved in the MAP kinase pathway. MKK6 Protein, Human (S207D, T211D, sf9, His-GST) is the recombinant human-derived MKK6 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

MKK6, a dual specificity protein kinase, serves as an integral component of the MAP kinase signal transduction pathway. In collaboration with MAP3K3/MKK3, MKK6 catalyzes the simultaneous phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11, MAPK12, MAPK13, and MAPK14, playing a pivotal role in regulating cellular responses to cytokines and various stress stimuli. Both MKK3 and MKK6 are essential for activating MAPK11 and MAPK13 in response to environmental stress, with MKK6 emerging as the principal activator of MAPK11 upon TNF stimulation. Additionally, MKK6 phosphorylates and activates PAK6. The downstream effects of the p38 MAP kinase signal transduction pathway include the direct activation of transcription factors such as ATF2 and ELK1. Within this pathway, MKK6 mediates the phosphorylation of STAT4 through MAPK14 activation, leading to the activation of STAT4 and its regulation of gene expression in response to IL-12 stimulation. Furthermore, the pathway is crucial for IL-6-induced SOCS3 expression and down-regulation of IL-6-mediated gene induction, as well as IFNG-dependent gene transcription. MKK6 plays a role in osteoclast differentiation through NF-kappa-B transactivation by TNFSF11, contributes to endochondral ossification, and likely influences SOX9 as a downstream target of the p38 MAPK pathway. Moreover, MKK6 is involved in mediating apoptotic cell death in thymocytes and serves as a regulator for melanocyte dendricity by modulating Rho family GTPases.

Biological Activity

The specific activity was determined to be > 200 nmol/min/mg using inactive MAPK14 as substrate.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P52564-1 (M1-D334, S207D, T211D)

Gene ID
Molecular Construction
N-term
His-GST
MKK6 (M1-D334, S207D, T211D)
Accession # P52564-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3
AA Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

분자량

Approximately 60 kDa

Purity
  • ≥ 85%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

MKK6 Protein, Human (Active, S207D, T211D, sf9, His-GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
MKK6 Protein, Human (Active, S207D, T211D, sf9, His-GST)
Cat. No.:
HY-P73811
수량:
MCE Japan Authorized Agent: