MMP-26 Protein, Human

Customer Review

Based on 1 Customer Validation

The MMP-26 protein has broad substrate specificity and hydrolyzes type IV collagen, fibronectin, fibrinogen, β-casein, type I gelatin, and α-1 protease inhibitors. The versatility of this enzyme suggests involvement in the degradation and remodeling of various extracellular matrix components. MMP-26 Protein, Human is the recombinant human-derived MMP-26 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MMP-26 protein has broad substrate specificity and hydrolyzes type IV collagen, fibronectin, fibrinogen, β-casein, type I gelatin, and α-1 protease inhibitors. The versatility of this enzyme suggests involvement in the degradation and remodeling of various extracellular matrix components. MMP-26 Protein, Human is the recombinant human-derived MMP-26 protein, expressed by E. coli , with tag free.

Background

The MMP-26 protein demonstrates a broad substrate specificity, as it may hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin, and alpha-1 proteinase inhibitor. Its capacity to enzymatically cleave these diverse substrates indicates its potential involvement in the degradation and remodeling of various extracellular matrix components. Additionally, MMP-26 is capable of activating progelatinase B, suggesting a regulatory role in modulating the activity of other matrix metalloproteinases. The diverse substrate hydrolysis and activation capabilities of MMP-26 underscore its significance in the dynamic processes of tissue remodeling and homeostasis within the extracellular matrix.

Verified Bioactivity

Measured by its ability to cleave the fluorogenic peptide substrate Mca-Pro-Leu-Gly-Leu-Dpa-Ala-Arg-NH2 and the specific activity is > 60 pmol/min/µg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MMP-26 (T90-P261)
      Accession # Q9NRE1
    • C-term
  • Protein Length

    Full Length of Mature Protein (with Propeptide)

  • Synonyms

    MMP26; MGC126592; Matrix Metallopeptidase 26; MGC126590; Endometase; MMP-26; Matrix Metalloproteinase-26; Matrix Metalloproteinase 26; Matrilysin 2; Matrilysin-2

  • AA Sequence

    TSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

  • Predicted Molecular Mass

    19.6 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 2 mM CaCl2, pH 7.8, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00