1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators Kinases
  3. Receptor Tyrosine Kinases Transferases (EC 2) Protein Tyrosine Kinases TK
  4. Muscle-Specific Kinase (MuSK) Musk
  5. MUSK Protein, Human (Active, sf9, His, GST)

MUSK protein is a receptor tyrosine kinase that plays a crucial role in the formation and maintenance of the neuromuscular junction (NMJ). After LRP4 recruits AGRIN, MUSK phosphorylates and activates, affecting gene expression, coordinating actin cytoskeletal reorganization, and clustering acetylcholine receptors (AChR) in the postsynaptic membrane. MUSK Protein, Human (sf9, His, GST) is the recombinant human-derived MUSK, expressed by Sf9 insect cells, with His, GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MUSK protein is a receptor tyrosine kinase that plays a crucial role in the formation and maintenance of the neuromuscular junction (NMJ). After LRP4 recruits AGRIN, MUSK phosphorylates and activates, affecting gene expression, coordinating actin cytoskeletal reorganization, and clustering acetylcholine receptors (AChR) in the postsynaptic membrane. MUSK Protein, Human (sf9, His, GST) is the recombinant human-derived MUSK, expressed by Sf9 insect cells, with His, GST labeled tag.

Background

The MUSK protein, a receptor tyrosine kinase, holds a pivotal role in the formation and maintenance of the neuromuscular junction (NMJ), the synapse connecting motor neurons to skeletal muscles. Upon AGRIN recruitment by LRP4 to the MUSK signaling complex, MUSK undergoes phosphorylation and activation, regulating NMJ formation by influencing gene expression in subsynaptic nuclei, orchestrating actin cytoskeleton reorganization, and clustering acetylcholine receptors (AChR) in the postsynaptic membrane. ABL1 and Src family kinases, activated by MUSK, may further regulate AChR phosphorylation and clustering. The ternary complex formed by MUSK, DVL1, and PAK1 is crucial for AChR clustering regulation. Additionally, MUSK positively regulates Rho family GTPases through FNTA, mediating the phosphorylation of FNTA and promoting the activation of RAC1, a key regulator of the actin cytoskeleton and gene expression. DNAJA3, acting downstream of MUSK, is another effector in the MUSK signaling pathway. Beyond the neuromuscular junction, MUSK may also contribute to cholinergic responses, synaptic plasticity, and memory formation within the central nervous system.

Species

Human

Source

Sf9 insect cells

Tag

His;GST

Accession

O15146-1 (R519-V869)

Gene ID

4593

Protein Length

Partial

Synonyms
MUSK; muscle associated receptor tyrosine kinase; CMS9; FADS; FADS1
AA Sequence

RRRKQWKNKKRESAAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNLMRLCWSKLPADRPSFTSIHRILERMCERAEGTVSV

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MUSK Protein, Human (Active, sf9, His, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MUSK Protein, Human (Active, sf9, His, GST)
Cat. No.:
HY-P702701
Quantity:
MCE Japan Authorized Agent: