Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His)

Measured by its binding ability in a functional ELISA.Immobilized Human Neuregulin-3/NRG3 at 2 μg/mL (100μL/well) can bind Human ErbB4/Her4 (HY-P73035).The ED₅₀ for this effect is 20.86 ng/mL.

• 
  Measured by its binding ability in a functional ELISA.Immobilized Human Neuregulin-3/NRG3 at 2 μg/mL (100μL/well) can bind Human ErbB4/Her4 (HY-P73035).The ED₅₀ for this effect is 20.86 ng/mL.

Human

HEK293

C-10*His

B9EGV5 (E282-P342)

10718

Partial

ERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDP

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.