1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Neurotrimin Protein, Human (HEK293, Fc)

Neurotrimin Protein, a neural cell adhesion molecule, plays a crucial role in facilitating neural connections through its adhesive properties. As a member of the cell adhesion molecule family, Neurotrimin influences various aspects of neural function, including cell adhesion, communication, and potential contributions to neuronal development and synaptic plasticity, underscoring its significance as a molecular mediator within the nervous system. Neurotrimin Protein, Human (HEK293, Fc) is the recombinant human-derived Neurotrimin protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neurotrimin Protein, a neural cell adhesion molecule, plays a crucial role in facilitating neural connections through its adhesive properties. As a member of the cell adhesion molecule family, Neurotrimin influences various aspects of neural function, including cell adhesion, communication, and potential contributions to neuronal development and synaptic plasticity, underscoring its significance as a molecular mediator within the nervous system. Neurotrimin Protein, Human (HEK293, Fc) is the recombinant human-derived Neurotrimin protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Neurotrimin, a neural cell adhesion molecule, serves as a crucial player in cellular interactions within the nervous system. As a member of the cell adhesion molecule family, Neurotrimin is implicated in facilitating neural connections through its adhesive properties. The protein's role encompasses various aspects of neural function, including cell adhesion, communication, and potentially influencing processes such as neuronal development and synaptic plasticity. Neurotrimin's involvement highlights its significance as a molecular mediator in the intricate network of interactions within the nervous system.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9P121-1 (G34-G312)

Gene ID
Molecular Construction
N-term
Neurotrimin (G34-G312)
Accession # Q9P121-1
hFc
C-term
Protein Length

Partial

Synonyms
Neurotrimin; hNT; NTM; IGLON2; NT
AA Sequence

GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFG

Predicted Molecular Mass
57.6 kDa
Molecular Weight

Approximately 66 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Neurotrimin Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Neurotrimin Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neurotrimin Protein, Human (HEK293, Fc)
Cat. No.:
HY-P74702
Quantity:
MCE Japan Authorized Agent: