Copy Link Print Information

NKp30/NCR3 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Rat (HEK293, His) is the recombinant rat-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for NKp30/NCR3 Protein, Rat (HEK293, His)
  • Experimental Validation Results for NKp30/NCR3 Protein, Rat (HEK293, His)
  • NKp30/NCR3 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Rat (HEK293, His) is the recombinant rat-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag.

Background

NKp30/NCR3 protein, serving as a cell membrane receptor on natural killer (NK) cells, becomes activated upon binding extracellular ligands such as BAG6 and NCR3LG1. Upon ligand binding, NKp30/NCR3 stimulates NK cell cytotoxicity against neighboring cells expressing these ligands, thereby exerting control over NK cell cytotoxicity against tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that failed to acquire a mature phenotype but also promotes DC maturation. This occurs through the release of TNFA and IFNG by NK cells, further contributing to the maturation process. In its unliganded form, NKp30/NCR3 forms homodimers and interacts with CD3Z, as well as with and is activated by binding to both NCR3LG1 and BAG6, unraveling its intricate roles in regulating immune responses, NK cell cytotoxicity, and DC maturation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Rat NKp30/NCR3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Human B7-H6. The ED50 for this effect is 42.39 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE. It migrates as an approximately 25-33 kDa band in SDS-PAGE under reducing conditions.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rat NKp30/NCR3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Human B7-H6. The ED50 for this effect is 42.39 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    Q8CFD9 (I19-S147)

  • Gene ID
    294251  [NCBI]
  • Molecular Construction
    • N-term
    • NKp30 (I19-S147)
      Accession # Q8CFD9
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    NCR3; Activating Natural Killer Receptor P30; Prev. LY117; NK-P30; NKp30; Activating NK-A1 Receptor; 1C7; CD337 Antigen; Natural Killer Cell P30-Related Protein; MALS; CD337; Natural Cytotoxicity Triggering Receptor 3; Lymphocyte Antigen 117

  • AA Sequence

    IWVSQPPEIRAQEGTTASLPCSFNASRGKAAIGSATWYQDKVAPGMELSNVTPGFRGRVASFSASQFIRGHKAGLLIQDIQSHDARIYVCRVEVLGLGVGTGNGTRLVVEKEPPQQASNAEPERAAYTS

  • Molecular Weight

    Approximately 25-33 kDa.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE. It migrates as an approximately 25-33 kDa band in SDS-PAGE under reducing conditions.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Rat NKp30/NCR3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Human B7-H6. The ED50 for this effect is 42.39 ng/mL.

  • NKp30/NCR3 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for NKp30/NCR3 Protein, Rat (HEK293, His)
  • Experimental Validation Results for NKp30/NCR3 Protein, Rat (HEK293, His)
  • NKp30/NCR3 Protein, Rat (HEK293, His) Product Image