1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins
  4. CD337/NCR3
  5. NKp30/NCR3 Protein, Rat (HEK293, His)

NKp30/NCR3 Protein, Rat (HEK293, His)

Cat. No.: HY-P77106
COA Handling Instructions

NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Rat (HEK293, His) is the recombinant rat-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag. The total length of NKp30/NCR3 Protein, Rat (HEK293, His) is 129 a.a., with molecular weight of ~25-33 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $80 In-stock
50 μg $225 In-stock
100 μg $380 In-stock
500 μg $1065 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NKp30/NCR3 protein is a cell membrane receptor on natural killer (NK) cells that activates cytotoxicity by binding to ligands such as BAG6 and NCR3LG1, stimulating NK cells to respond against neighboring cells (including tumor cells) expressing these ligands. NKp30/NCR3 Protein, Rat (HEK293, His) is the recombinant rat-derived NKp30/NCR3 protein, expressed by HEK293 , with C-His labeled tag. The total length of NKp30/NCR3 Protein, Rat (HEK293, His) is 129 a.a., with molecular weight of ~25-33 KDa.

Background

NKp30/NCR3 protein, serving as a cell membrane receptor on natural killer (NK) cells, becomes activated upon binding extracellular ligands such as BAG6 and NCR3LG1. Upon ligand binding, NKp30/NCR3 stimulates NK cell cytotoxicity against neighboring cells expressing these ligands, thereby exerting control over NK cell cytotoxicity against tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that failed to acquire a mature phenotype but also promotes DC maturation. This occurs through the release of TNFA and IFNG by NK cells, further contributing to the maturation process. In its unliganded form, NKp30/NCR3 forms homodimers and interacts with CD3Z, as well as with and is activated by binding to both NCR3LG1 and BAG6, unraveling its intricate roles in regulating immune responses, NK cell cytotoxicity, and DC maturation.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat NKp30/NCR3 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Human B7-H6. The ED50 for this effect is 42.39 ng/mL.

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q8CFD9 (I19-S147)

Gene ID

294251  [NCBI]

Molecular Construction
N-term
NKp30 (I19-S147)
Accession # Q8CFD9
His
C-term
Synonyms
Natural cytotoxicity triggering receptor 3; NK-p30; CD337; NCR3
AA Sequence

IWVSQPPEIRAQEGTTASLPCSFNASRGKAAIGSATWYQDKVAPGMELSNVTPGFRGRVASFSASQFIRGHKAGLLIQDIQSHDARIYVCRVEVLGLGVGTGNGTRLVVEKEPPQQASNAEPERAAYTS

Molecular Weight

Approximately 25-33 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKp30/NCR3 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp30/NCR3 Protein, Rat (HEK293, His)
Cat. No.:
HY-P77106
Quantity:
MCE Japan Authorized Agent: