NKp44/NCR2 Protein, Human (Biotinylated, HEK293, His)

The NKp44/NCR2 protein is a cytotoxicity-activating receptor on natural killer (NK) cells that may increase their tumor cell lysis efficiency. NKp44/NCR2 interacts with TYROBP/DAP12, an important signal transduction adapter, and is critical for transducing signals that activate NK cells against target cells. NKp44/NCR2 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived NKp44/NCR2 protein, expressed by HEK293 , with C-His labeled tag.

The NKp44/NCR2 protein functions as a cytotoxicity-activating receptor, potentially enhancing the efficiency of activated natural killer (NK) cells in mediating the lysis of tumor cells. This receptor interacts with TYROBP/DAP12, a crucial signaling adapter protein, which is essential for transducing signals that lead to NK cell activation and cytotoxicity against target cells. Additionally, NKp44/NCR2 protein interacts with KMT2E isoform NKp44L, further contributing to the complex molecular interactions involved in the regulation of NK cell responses. The collaborative engagement of NKp44/NCR2 with these signaling partners underscores its significance in the immune surveillance and anti-tumor activities of activated NK cells.

Human

HEK293

C-His

O95944 (Q22-P190)

9436  [NCBI]

Extracellular Domain

Biotin

QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.