1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins
  4. CD336/NCR2
  5. NKp44/NCR2 Protein, Human (HEK293, His)

NKp44/NCR2 Protein, Human (HEK293, His)

Cat. No.: HY-P72502
COA Handling Instructions

The NKp44/NCR2 protein is a cytotoxicity-activating receptor on natural killer (NK) cells that may increase their tumor cell lysis efficiency. NKp44/NCR2 interacts with TYROBP/DAP12, an important signal transduction adapter, and is critical for transducing signals that activate NK cells against target cells. NKp44/NCR2 Protein, Human (169a.a, HEK293, His) is the recombinant human-derived NKp44/NCR2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NKp44/NCR2 Protein, Human (169a.a, HEK293, His) is 169 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $80 In-stock
50 μg $210 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

NKp44/NCR2 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKp44/NCR2 protein is a cytotoxicity-activating receptor on natural killer (NK) cells that may increase their tumor cell lysis efficiency. NKp44/NCR2 interacts with TYROBP/DAP12, an important signal transduction adapter, and is critical for transducing signals that activate NK cells against target cells. NKp44/NCR2 Protein, Human (169a.a, HEK293, His) is the recombinant human-derived NKp44/NCR2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NKp44/NCR2 Protein, Human (169a.a, HEK293, His) is 169 a.a., with molecular weight of 30-40 kDa.

Background

The NKp44/NCR2 protein functions as a cytotoxicity-activating receptor, potentially enhancing the efficiency of activated natural killer (NK) cells in mediating the lysis of tumor cells. This receptor interacts with TYROBP/DAP12, a crucial signaling adapter protein, which is essential for transducing signals that lead to NK cell activation and cytotoxicity against target cells. Additionally, NKp44/NCR2 protein interacts with KMT2E isoform NKp44L, further contributing to the complex molecular interactions involved in the regulation of NK cell responses. The collaborative engagement of NKp44/NCR2 with these signaling partners underscores its significance in the immune surveillance and anti-tumor activities of activated NK cells.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95944/NP_004819.2 (Q22-P190)

Gene ID
Molecular Construction
N-term
NKp44 (Q22-P190)
Accession # O95944
6*His
C-term
Synonyms
Natural cytotoxicity triggering receptor 2; NKp44; CD336; NCR2; LY95
AA Sequence

QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

Molecular Weight

Approximately 30-40 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 ,8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKp44/NCR2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp44/NCR2 Protein, Human (HEK293, His)
Cat. No.:
HY-P72502
Quantity:
MCE Japan Authorized Agent: