NKp44/NCR2 Protein, Human (HEK293, His)

The NKp44/NCR2 protein is a cytotoxicity-activating receptor on natural killer (NK) cells that may increase their tumor cell lysis efficiency. NKp44/NCR2 interacts with TYROBP/DAP12, an important signal transduction adapter, and is critical for transducing signals that activate NK cells against target cells. NKp44/NCR2 Protein, Human (HEK293, His) is the recombinant human-derived NKp44/NCR2 protein, expressed by HEK293 , with C-6*His labeled tag.

The NKp44/NCR2 protein functions as a cytotoxicity-activating receptor, potentially enhancing the efficiency of activated natural killer (NK) cells in mediating the lysis of tumor cells. This receptor interacts with TYROBP/DAP12, a crucial signaling adapter protein, which is essential for transducing signals that lead to NK cell activation and cytotoxicity against target cells. Additionally, NKp44/NCR2 protein interacts with KMT2E isoform NKp44L, further contributing to the complex molecular interactions involved in the regulation of NK cell responses. The collaborative engagement of NKp44/NCR2 with these signaling partners underscores its significance in the immune surveillance and anti-tumor activities of activated NK cells.

Human

HEK293

C-6*His

O95944/NP_004819.2 (Q22-P190)

9436  [NCBI]

Extracellular Domain

QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP

Approximately 30-40 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 ,8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.