1. Recombinant Proteins
  2. Others
  3. NPPB Protein, Human (76a.a, Flag-His)

NPPB Protein, Human (76a.a, Flag-His)

Cat. No.: HY-P71120
COA Handling Instructions

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (76a.a, Flag-His) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His, N-Flag labeled tag. The total length of NPPB Protein, Human (76a.a, Flag-His) is 76 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (76a.a, Flag-His) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His, N-Flag labeled tag. The total length of NPPB Protein, Human (76a.a, Flag-His) is 76 a.a., with molecular weight of ~14.0 kDa.

Background

TRIM5 protein serves as a capsid-specific restriction factor, impeding the infection of non-host-adapted retroviruses by blocking viral replication early in the viral life cycle, specifically after viral entry but before reverse transcription. Beyond its role as a capsid-specific restriction factor, TRIM5 also functions as a pattern recognition receptor, activating innate immune signaling in response to the retroviral capsid lattice. Upon binding to the viral capsid, TRIM5 triggers its E3 ubiquitin ligase activity, collaborating with the UBE2V1-UBE2N complex to generate 'Lys-63'-linked polyubiquitin chains. This ubiquitination process leads to the autophosphorylation of the MAP3K7/TAK1 complex, resulting in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, ultimately initiating an innate immune response in the infected cell. TRIM5's restrictive capabilities extend to various retroviruses, including N-tropic murine leukemia virus (N-MLV), equine infectious anemia virus (EIAV), simian immunodeficiency virus of macaques (SIVmac), feline immunodeficiency virus (FIV), and bovine immunodeficiency virus (BIV). Additionally, TRIM5 plays a crucial role in regulating autophagy by activating the autophagy regulator BECN1, causing its dissociation from inhibitors BCL2 and TAB2. Furthermore, TRIM5 acts as a selective autophagy receptor, recognizing and targeting HIV-1 capsid protein p24 for autophagic degradation.

Species

Human

Source

E. coli

Tag

N-6*His;N-Flag

Accession

P16860 (H27-R102)

Gene ID
Molecular Construction
N-term
6*His-Flag
NPPB (H27-R102)
Accession # P16860
C-term
Synonyms
Natriuretic peptides B; Gamma-brain natriuretic peptide; NPPB; BNP; NT-proBNP
AA Sequence

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

NPPB Protein, Human (76a.a, Flag-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NPPB Protein, Human (76a.a, Flag-His)
Cat. No.:
HY-P71120
Quantity:
MCE Japan Authorized Agent: