1. Recombinant Proteins
  2. Receptor Proteins
  3. LOX-1/OLR1 Protein, Human (HEK293, His)

The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

OLR1, a pivotal receptor, plays a crucial role in mediating the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. The binding of oxLDL to OLR1 triggers vascular endothelial cell activation and dysfunction, leading to pro-inflammatory responses, increased oxidative conditions, and apoptosis, highlighting its significance as a marker of atherosclerosis. This interaction with oxLDL activates NF-kappa-B, resulting in heightened intracellular reactive oxygen species production and a range of pro-atherogenic cellular responses, including diminished nitric oxide release, increased monocyte adhesion, and apoptosis. Beyond its involvement in atherosclerosis, OLR1 acts as a receptor for the HSP70 protein, contributing to antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Furthermore, OLR1 functions as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation and serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. In the context of microbial infection, OLR1 may act as a receptor for adhesin A variant 3 (nadA) of N.meningitidis.

Biological Activity

Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.797 μg/ml, corresponding to a specific activity is 1.25×10^3 units/mg.

  • Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 0.797 μg/mL, corresponding to a specific activity is 1.25×103 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P78380-1 (S61-Q273)

Gene ID
Molecular Construction
N-term
LOX-1 (S61-Q273)
Accession # P78380-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Oxidized Low-Density Lipoprotein Receptor 1; Ox-LDL Receptor 1; C-Type Lectin Domain Family 8 Member A; Lectin-Like Oxidized LDL Receptor 1; LOX-1; Lectin-Like oxLDL Receptor 1; hLOX-1; Lectin-Type Oxidized LDL Receptor 1; OLR1; CLEC8A; LOX1
AA Sequence

SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Molecular Weight

30-35 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

LOX-1/OLR1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LOX-1/OLR1 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LOX-1/OLR1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71180
Quantity:
MCE Japan Authorized Agent: