1. Recombinant Proteins
  2. Receptor Proteins
  3. OLR1 Protein, Human (HEK293, His)

OLR1 Protein, Human (HEK293, His)

Cat. No.: HY-P71180
COA Handling Instructions

The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $36 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
500 μg $1000 In-stock
1 mg $1600 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

OLR1, a pivotal receptor, plays a crucial role in mediating the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. The binding of oxLDL to OLR1 triggers vascular endothelial cell activation and dysfunction, leading to pro-inflammatory responses, increased oxidative conditions, and apoptosis, highlighting its significance as a marker of atherosclerosis. This interaction with oxLDL activates NF-kappa-B, resulting in heightened intracellular reactive oxygen species production and a range of pro-atherogenic cellular responses, including diminished nitric oxide release, increased monocyte adhesion, and apoptosis. Beyond its involvement in atherosclerosis, OLR1 acts as a receptor for the HSP70 protein, contributing to antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Furthermore, OLR1 functions as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation and serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. In the context of microbial infection, OLR1 may act as a receptor for adhesin A variant 3 (nadA) of N.meningitidis.

Biological Activity

Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.797 μg/ml, corresponding to a specific activity is 1.25×10^3 units/mg.

  • Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 0.797 μg/ml, corresponding to a specific activity is 1.25×103 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P78380-1 (S61-Q273)

Gene ID
Molecular Construction
N-term
OLR1 (S61-Q273)
Accession # P78380-1
6*His
C-term
Synonyms
Oxidized Low-Density Lipoprotein Receptor 1; Ox-LDL Receptor 1; C-Type Lectin Domain Family 8 Member A; Lectin-Like Oxidized LDL Receptor 1; LOX-1; Lectin-Like oxLDL Receptor 1; hLOX-1; Lectin-Type Oxidized LDL Receptor 1; OLR1; CLEC8A; LOX1
AA Sequence

SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

Molecular Weight

30-35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

OLR1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OLR1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71180
Quantity:
MCE Japan Authorized Agent: