LOX-1/OLR1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL). As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
OLR1, a pivotal receptor, plays a crucial role in mediating the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. The binding of oxLDL to OLR1 triggers vascular endothelial cell activation and dysfunction, leading to pro-inflammatory responses, increased oxidative conditions, and apoptosis, highlighting its significance as a marker of atherosclerosis. This interaction with oxLDL activates NF-kappa-B, resulting in heightened intracellular reactive oxygen species production and a range of pro-atherogenic cellular responses, including diminished nitric oxide release, increased monocyte adhesion, and apoptosis. Beyond its involvement in atherosclerosis, OLR1 acts as a receptor for the HSP70 protein, contributing to antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Furthermore, OLR1 functions as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation and serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. In the context of microbial infection, OLR1 may act as a receptor for adhesin A variant 3 (nadA) of N.meningitidis.
Verified Bioactivity
Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.797 μg/ml, corresponding to a specific activity is 1.25×10^3 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P78380-1 (S61-Q273)
-
Molecular Construction
-
N-term
-
LOX-1 (S61-Q273)
Accession # P78380-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
OLR1; CDNA, FLJ79252, Weakly Similar To Oxidized Low-Density Lipoprotein Receptor 1; Oxidized Low Density Lipoprotein Receptor 1; Oxidised Low Density Lipoprotein (Lectin-Like) Receptor 1; CLEC8A; Oxidized Low Density Lipoprotein (Lectin-Like) Receptor 1;
-
AA Sequence
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)