OLR1 Protein, Human (HEK293, His)

OLR1 Protein, a receptor on vascular endothelial cells, plays a key role in recognizing, internalizing, and degrading oxidatively modified low-density lipoprotein (oxLDL). As a marker of atherosclerosis, oxLDL induces vascular endothelial cell activation, leading to pro-inflammatory responses, oxidative conditions, and apoptosis. OLR1's association with oxLDL activates NF-kappa-B, contributing to pro-atherogenic responses such as reduced nitric oxide release, monocyte adhesion, and apoptosis. Beyond oxLDL, it serves as a receptor for HSP70, participating in cell-mediated antigen cross-presentation and functioning as a leukocyte-adhesion molecule in inflammation. Additionally, OLR1 recognizes AGE products, activated platelets, monocytes, apoptotic cells, and bacteria. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293, with C-6*His labeled tag. The total length of OLR1 Protein, Human (HEK293, His) is 213 a.a., with molecular weight of 30-35 kDa.

OLR1, a pivotal receptor, plays a crucial role in mediating the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. The binding of oxLDL to OLR1 triggers vascular endothelial cell activation and dysfunction, leading to pro-inflammatory responses, increased oxidative conditions, and apoptosis, highlighting its significance as a marker of atherosclerosis. This interaction with oxLDL activates NF-kappa-B, resulting in heightened intracellular reactive oxygen species production and a range of pro-atherogenic cellular responses, including diminished nitric oxide release, increased monocyte adhesion, and apoptosis. Beyond its involvement in atherosclerosis, OLR1 acts as a receptor for the HSP70 protein, contributing to antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Furthermore, OLR1 functions as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation and serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. In the context of microbial infection, OLR1 may act as a receptor for adhesin A variant 3 (nadA) of N.meningitidis.

Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ for this effect is 0.797 μg/ml, corresponding to a specific activity is 1.25×10^3 units/mg.

• 
  Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ this effect is 0.797 μg/ml, corresponding to a specific activity is 1.25×10³ units/mg.

Human

HEK293

C-6*His

P78380 (S61-Q273)

4973  [NCBI]

SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

30-35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.