OSM Protein, Human (Biotinylated, HEK293, His-Avi)

OSM protein is a multifunctional growth regulator with dual functions of inhibiting tumor cell lines and stimulating the proliferation of AIDS-KS cells. It coordinates the production of cytokines, including IL-6, G-CSF, and GM-CSF, and binds to type I and type II OSM receptors, forming heterodimers with LIFR/IL6ST and OSMR/IL6ST, respectively. OSM Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived OSM protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

OSM Protein stands as a versatile growth regulator with dual inhibitory effects on the proliferation of various tumor cell lines and stimulatory effects on AIDS-KS cell proliferation. Notably, OSM orchestrates the regulation of cytokine production, including IL-6, G-CSF, and GM-CSF from endothelial cells. This multifaceted growth regulator engages both the type I OSM receptor, forming heterodimers composed of LIFR and IL6ST, and the type II OSM receptor, forming heterodimers composed of OSMR and IL6ST. Beyond its antiproliferative and proliferative roles, OSM plays a crucial part in the maturation of fetal hepatocytes, contributing significantly to liver development and regeneration.

Human

HEK293

C-Avi;C-8*His

P13725 (A26-R221)

5008  [NCBI]

Full Length of Mature Protein

Biotin

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.