1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands
  5. OX40 Ligand
  6. OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

Cat. No.: HY-P72498
Handling Instructions Technical Support

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs. OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is a recombinant cynomolgus OX40 Ligand (Q51-L183) with N-terminal 8*His tag, which is produced in HEK293.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is a recombinant cynomolgus OX40 Ligand (Q51-L183) with N-terminal 8*His tag, which is produced in HEK293.

Background

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is expressed on antigen-presenting cells, such as B cells, dendritic cells (DCs), and macrophages, and airway smooth muscle cells[3]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family.
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2].
Human OX40 Ligand shares <70% aa sequence identity with mouse, rat and rabbit.
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity[4]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease[1].

In Vitro

OX40 Ligand (human, 100 ng/mL, 7 days, added into DC-T cell cultures at days 0 and 4) inhibits the generation of IL-10-producing T cells induced by immature DCs and DCs treated with IL-10 and IFN-α[5].

Species

Cynomolgus

Source

HEK293

Tag

N-8*His

Accession

F7FL80 (Q51-L183)/A0A2K5TTN0 (Q81-L213)

Gene ID
Molecular Construction
N-term
8*His
OX40L (Q51-L183)
Accession # F7FL80
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor ligand superfamily member 4; OX40 ligand; OX40L; CD252; Tnfsf4
AA Sequence

QVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Predicted Molecular Mass
16.5 kDa
분자량

Approximately 23-38 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P72498
수량:
MCE Japan Authorized Agent: