1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands
  5. OX40 Ligand
  6. OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P77457
Handling Instructions Technical Support

The OX40 ligand/TNFSF4 protein is an important member of the tumor necrosis factor family and is critical for regulating immune responses and inflammation. Its research enhances understanding of immune regulation and provides potential applications for immunotherapy and autoimmune disease management. OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The OX40 ligand/TNFSF4 protein is an important member of the tumor necrosis factor family and is critical for regulating immune responses and inflammation. Its research enhances understanding of immune regulation and provides potential applications for immunotherapy and autoimmune disease management. OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

The OX40 Ligand/TNFSF4 Protein is a significant member of the tumor necrosis factor family, indicating its essential role in regulating immune responses and inflammatory processes. As part of this family, OX40 Ligand/TNFSF4 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in signaling pathways associated with immune modulation. The classification within the tumor necrosis factor family underscores its specific designation within the broader context of cytokines, providing insights into its unique contributions to T cell activation and co-stimulation. The study of OX40 Ligand/TNFSF4 contributes to our understanding of its role in immune homeostasis, offering potential applications in immunotherapy and autoimmune disease management. Further exploration of OX40 Ligand/TNFSF4's role holds promise for enhancing our knowledge of its contributions to both normal immune function and pathological conditions.

In Vitro

OX4 Ligand (human, 1 ng/mL, 7 days, added into DC-T cell cultures at days and 4) inhibits the generation of IL-1-producing T cells induced by immature DCs and DCs treated with IL-1 and IFN-α[5].

Species

Cynomolgus

Source

HEK293

Tag

N-mFc

Accession

F7FL80 (Q51-L183)/A0A2K5TTN0 (Q81-L213)

Gene ID
Molecular Construction
N-term
mFc
OX40L (Q51-L183)
Accession # F7FL80
C-term
Protein Length

Partial

Synonyms
CD134L; CD252; Glycoprotein Gp34; OX40 antigen ligand; OX40L; TXGP1
AA Sequence

QVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Predicted Molecular Mass
42 kDa
Molecular Weight

Approximately 48 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OX40 Ligand/TNFSF4 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P77457
Quantity:
MCE Japan Authorized Agent: